ESTScan Details for Unigene SGN-U223702

Score 
418
Direction 
Forward
Predicted Peptide Sequence 
DGESGLLLFEQMRKLRRLEPNGDTFSVVLSACASKGYVKEGFTYFELMKNEYGIVPGVEHYLGIADVLGKSGHLNELLEFIEDMPIEPTK
VVWEAVINFARIHGDIELEDRTEELLIMLDSSRNMADKPVAPFQKRHSEFNMLEGKDRVNEFKSTIPHRADAYEKLKGLSGQMRDSGYVP
DTRYVLHDIDEAAKEQALMYHSERLAIAYGLISTPARTTLRIIKNLRICGDCHNAIKIMSKIVGRELIVRDNKRFHHFRDGNAPVMTTGE
VNSLDSAITVFLFVEFVNPLGAVVLGIIFTGSX
Predicted Coding Sequence 
GATGGGGAGAGTGGTTTGCTTTTGTTTGAGCAGATGAGAAAACTTAGACGGTTGGAGCCCAATGGGGACACTTTTTCCGTGGTGCTTTCA
GCCTGTGCTAGTAAGGGGTATGTGAAAGAAGGTTTTACGTATTTTGAGCTAATGAAGAATGAATATGGCATTGTTCCTGGAGTTGAGCAT
TACTTAGGGATCGCTGATGTTTTGGGAAAATCTGGGCATTTGAATGAATTGCTAGAGTTTATTGAAGACATGCCTATTGAGCCTACAAAA
GTAGTATGGGAGGCCGTGATAAATTTTGCACGAATTCATGGGGATATTGAACTTGAAGATCGAACGGAGGAGCTGCTCATTATGTTAGAT
TCTTCCAGAAATATGGCTGATAAGCCGGTTGCACCATTTCAGAAAAGGCATTCTGAGTTTAATATGCTTGAGGGTAAAGACAGAGTTAAT
GAGTTCAAGAGCACAATTCCACATAGGGCAGATGCATATGAAAAATTGAAAGGCTTAAGCGGGCAGATGAGGGATTCTGGCTATGTACCA
GACACGAGGTATGTGCTTCATGATATTGACGAGGCCGCTAAGGAGCAAGCGCTGATGTATCATAGTGAGCGATTGGCTATTGCATATGGT
TTAATTAGTACTCCGGCAAGAACAACTCTTAGGATCATCAAGAACCTCCGGATATGCGGTGACTGTCACAACGCCATTAAGATCATGTCA
AAGATTGTTGGGCGAGAGTTGATTGTCAGAGATAACAAACGGTTTCATCATTTCAGAGATGGAAATGCTCCTGTAATGACTACTGGTGAA
GTCAATAGTCTAGATTCAGCTATTACTGTGTTTTTGTTTGTAGAATTTGTAAATCCACTTGGAGCAGTTGTTCTCGGGATCATATTTACA
GGATCATXX\
Edits in Original Sequence 
(5')GATGGGGAGAGTGGTTTGCTTTTGTTTGAGCAGATGAGAAAACTTAGACGGTTGGAGCCCAATGGGGACACTTTTTCCGTGGTGCT
TTCAGCCTGTGCTAGTAAGGGGTATGTGAAAGAAGGTTTTACGTATTTTGAGCTAATGAAGAATGAATATGGCATTGTTCCTGGAGTTGA
GCATTACTTAGGGATCGCTGATGTTTTGGGAAAATCTGGGCATTTGAATGAATTGCTAGAGTTTATTGAAGACATGCCTATTGAGCCTAC
AAAAGTAGTATGGGAGGCCGTGATAAATTTTGCACGAATTCATGGGGATATTGAACTTGAAGATCGAACGGAGGAGCTGCTCATTATGTT
AGATTCTTCCAGAAATATGGCTGATAAGCCGGTTGCACCATTTCAGAAAAGGCATTCTGAGTTTAATATGCTTGAGGGTAAAGACAGAGT
TAATGAGTTCAAGAGCACAATTCCACATAGGGCAGATGCATATGAAAAATTGAAAGGCTTAAGCGGGCAGATGAGGGATTCTGGCTATGT
ACCAGACACGAGGTATGTGCTTCATGATATTGACGAGGCCGCTAAGGAGCAAGCGCTGATGTATCATAGTGAGCGATTGGCTATTGCATA
TGGTTTAATTAGTACTCCGGCAAGAACAACTCTTAGGATCATCAAGAACCTCCGGATATGCGGTGACTGTCACAACGCCATTAAGATCAT
GTCAAAGATTGTTGGGCGAGAGTTGATTGTCAGAGATAACAAACGGTTTCATCATTTCAGAGATGGtAAATGCTCCTGTAATGACTACTG
GTGAAGTCAATAGTCTAGATTCAgGCTATTACTGTGTTTTTGTTTGTAGAATTTGTAAATCCACTTGGAGCAGTaTGTTCTCGGGATCAT
ATTTACAGGATCATXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan