ESTScan Details for Unigene SGN-U223776

Score 
164
Direction 
Forward
Predicted Peptide Sequence 
DGTIRVWNINVRYHLSEDPKTLKVFPIPLKDASGTTLHYDRLCVSPDGKILATTHGSMMQWLCMETGKVLETAEKAHDGDITDMAWSPSP
IPMGDKKVLVLATASVDKKVKLWAAPSLNASXNDKYLMSXPSFLKNRSEEENTAEVRGLSAYIF
Predicted Coding Sequence 
XXGGATGGTACCATCAGAGTGTGGAATATTAATGTACGTTATCACCTTTCTGAGGACCCCAAGACATTAAAGGTGTTCCCTATTCCCCTT
AAGGATGCAAGTGGCACAACTTTACACTATGATCGTTTATGTGTATCACCTGATGGAAAGATATTGGCCACCACTCATGGTTCAATGATG
CAATGGCTATGTATGGAGACTGGGAAGGTTCTGGAAACAGCTGAAAAAGCACATGATGGTGATATCACGGACATGGCATGGTCGCCTTCT
CCAATTCCAATGGGTGACAAGAAAGTTCTGGTGTTGGCCACAGCCAGTGTCGATAAGAAAGTGAAGTTGTGGGCAGCTCCATCCCTGAAT
GCATCAXTGAATGACAAGTATTTGATGTCTCXGCCTAGTTTTTTGAAGAATAGATCAGAAGAGGAGAATACAGCCGAAGTTCGAGGATTG
AGTGCTTACATCTTTTAA\
Edits in Original Sequence 
(5')XXGGATGGTACCATCAGAGTGTGGAATATTAATGTACGTTATCACCTTTCTGAGGACCCCAAGACATTAAAGGTGTTCCCTATTCC
CCTTAAGGATGCAAGTGGCACAACTTTACACTATGATCGTTTATGTGTATCACCTGATGGAAAGATATTGGCCACCACTCATGGTTCAAT
GATGCAATGGCTATGTATGGAGACTGGGAAGGTTCTGGAAACAGCTGAAAAAGCACATGATGGTGATATCACGGACATGGCATGGTCGCC
TTCTCCAATTCCAATGGGTGACAAGAAAGTTCTGGTGTTGGCCACAGCCAGTGTCGATAAGAAAGTGAAGTTGTGGGCAGCTCCATCCCT
GAATGCATCAXTGAATGACAAGTATTTGATGTCTCXGCCTAGTTTTTTGAAcGAATAGATCAGAAGAGGAGAATACAGCCGAAGTTCGAG
GATTGAGTGCTTACATCTTTTAA\(3')GGGCTTTGTTATTTAAAGAGAGACTTAACCAGAATGTGGTGAAGCTAGAGAAAAATTTTGAT
GTTTAATTTAATGTTATATATACATGGGTGGTAGGTAGTTTTCTCTGCCAAGCTCCAAGGGATTGTGAGGTGTTACTGATCTATTTTAGA
GCTTAAAACCTACTTTTTTCTGTTTCAATTTAAAAGAAAATTATATATTTTGCAAGTTAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan