Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U223791

Score 
522
Direction 
Reverse
Predicted Peptide Sequence 
SIPEEFKNLTLLMDLDLHSNRFSGNLRAILSKNFQDPLGHYNSIDLAYNMFNGPLDENIGNEPVMDSILSLSLSHNPLTGHIPKSLGNLT
TLQEIKLAENGLTGGIPTELGNAKELKTILLSNNNLEGAIPAQVLNLKDLQEFDVSENRLSGSIPPHKAKIPKSAFLGNHGLCGAPLPPC
SHTXW
Predicted Coding Sequence 
TCGATCCCTGAGGAATTCAAGAACCTGACACTGCTGATGGATCTTGATCTTCACTCAAACAGATTTTCAGGCAACTTGAGAGCAATTTTG
TCCAAGAATTTTCAAGACCCCCTTGGCCACTACAATTCTATTGATCTTGCATACAACATGTTCAATGGACCATTAGACGAAAACATAGGG
AATGAACCTGTCATGGACTCTATTTTGTCACTAAGTTTGTCCCACAATCCATTAACAGGACACATACCAAAATCACTGGGAAATTTGACA
ACTTTGCAGGAAATTAAACTAGCTGAGAATGGGCTAACAGGTGGGATTCCAACAGAACTTGGGAATGCCAAAGAACTGAAAACAATTCTA
CTTTCAAATAACAATTTGGAAGGTGCAATACCAGCTCAGGTTCTGAATTTGAAAGACCTACAAGAATTTGATGTATCGGAAAATCGACTA
AGCGGTAGTATCCCTCCTCATAAAGCTAAAATCCCAAAGTCTGCATTTTTGGGAAATCATGGCTTGTGTGGAGCTCCACTTCCTCCTTGT
AGCCACACATAGTGG\
Edits in Original Sequence 
(5')TCGATCCCTGAGGAATTCAAGAACCTGACACTGCTGATGGATCTTGATCTTCACTCAAACAGATTTTCAGGCAACTTGAGAGCAAT
TTTGTCCAAGAATTTTCAAGACCCCCTTGGCCACTACAATTCTATTGATCTTGCATACAACATGTTCAATGGACCATTAGACGAAAACAT
AGGGAATGAACCTGTCATGGACTCTATTTTGTCACTAAGTTTGTCCCACAATCCATTAACAGGACACATACCAAAATCACTGGGAAATTT
GACAACTTTGCAGGAAATTAAACTAGCTGAGAATGGGCTAACAGGTGGGATTCCAACAGAACTTGGGAATGCCAAAGAACTGAAAACAAT
TCTACTTTCAAATAACAATTTGGAAGGTGCAATACCAGCTCAGGTTCTGAATTTGAAAGACCTACAAGAATTTGATGTATCGGAAAATCG
ACTAAGCGGTAGTATCCCTCCTCATAAAGCTAAAATCCCAAAGTCTGCATTTTTGGGAAATCATGGCTTGTGTGGAGCTCCACTTCCTCC
TTGTAGCCACACATAGTGG\(3')AAACCTTCAAACACAATATCTCCCTTTTACTTTATTTATTCTTCATTTTCGACATGATTATTCGTC
ATAATGTATTGTATTTCAGTTGTAATCAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan