ESTScan Details for Unigene SGN-U223848

Score 
473
Direction 
Forward
Predicted Peptide Sequence 
KMLAKDQIPPDALTYNILINAFCRAGKVDRARNIIGFMRKNGCQPNIVNYTALMNGFCKEGRVEDAKEVFHEMKGVGLKPDVVGYTTLIN
SFCRAGKVDEGIELLDEMKDKGCKADDVTIKIILGGLCRASRSSEAFNMLERLPYDGVHLSKESYRIVLNFLCKEGELVKAMDLLGLMLA
RRFVPHFATSNELIVQLCEAGKAADAALALFGLLEMGFKPEPQTWSMLIDXDMQGKKVVACISIT
Predicted Coding Sequence 
AAAATGCTTGCTAAGGATCAGATTCCGCCAGATGCATTGACTTACAATATCTTAATAAATGCATTTTGTCGTGCAGGAAAGGTGGATAGA
GCTAGGAACATAATAGGATTCATGAGGAAAAATGGATGTCAACCAAATATAGTTAATTACACAGCTTTGATGAATGGATTTTGTAAAGAA
GGAAGAGTTGAAGATGCCAAGGAGGTATTTCATGAGATGAAGGGAGTAGGCCTAAAACCAGATGTAGTAGGATATACAACATTAATCAAT
TCCTTCTGTAGGGCTGGTAAGGTTGACGAAGGCATCGAGTTACTTGATGAAATGAAGGATAAAGGGTGTAAAGCTGATGATGTGACAATA
AAAATCATACTCGGGGGATTGTGCAGAGCCTCTAGATCAAGTGAAGCTTTCAATATGCTTGAGAGGTTACCTTATGATGGTGTCCATCTA
AGTAAAGAAAGTTACAGGATTGTGTTAAATTTCTTGTGTAAAGAAGGTGAGCTAGTAAAGGCGATGGACTTGTTGGGTTTGATGTTGGCT
AGACGATTTGTGCCCCATTTTGCTACGTCTAATGAACTGATAGTTCAACTATGCGAGGCTGGAAAGGCAGCTGATGCAGCTTTGGCATTG
TTTGGGCTGTTAGAGATGGGGTTTAAGCCAGAGCCTCAGACATGGAGTATGTTGATTGATGXTGATATGCAGGGAAAGAAAGTTGTTGCC
TGCATTTCAATTACTTGA\
Edits in Original Sequence 
(5')AAAATGCTTGCTAAGGATCAGATTCCGCCAGATGCATTGACTTACAATATCTTAATAAATGCATTTTGTCGTGCAGGAAAGGTGGA
TAGAGCTAGGAACATAATAGGATTCATGAGGAAAAATGGATGTCAACCAAATATAGTTAATTACACAGCTTTGATGAATGGATTTTGTAA
AGAAGGAAGAGTTGAAGATGCCAAGGAGGTATTTCATGAGATGAAGGGAGTAGGCCTAAAACCAGATGTAGTAGGATATACAACATTAAT
CAATTCCTTCTGTAGGGCTGGTAAGGTTGACGAAGGCATCGAGTTACTTGATGAAATGAAGGATAAAGGGTGTAAAGCTGATGATGTGAC
AATAAAAATCATACTCGGGGGATTGTGCAGAGCCTCTAGATCAAGTGAAGCTTTCAATATGCTTGAGAGGTTACCTTATGATGGTGTCCA
TCTAAGTAAAGAAAGTTACAGGATTGTGTTAAATTTCTTGTGTAAAGAAGGTGAGCTAGTAAAGGCGATGGACTTGTTGGGTTTGATGTT
GGCTAGACGATTTGTGCCCCATTTTGCTACGTCTAATGAACTGATAGTTCAACTATGCGAGGCTGGAAAGGCAGCTGATGCAGCTTTGGC
ATTGTTTGGGCTGTTAGAGATGGGGTTTAAGCCAGAGCCTCAGACATGGAGTATGTTGATTGATGXTGATATGCAGGGAAAGAAAGTTGT
TGCCTGCATTTCAATTACTTGA\(3')TGAGTTGGTTCTGCAATAGTTACTACTCACATGTGTTGTGATTTTAGGCATTTTGTATTCTTC
TTCAGTGACTTTTTTTTATAAAGAAGATAGTTGAATATGCCAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan