ESTScan Details for Unigene SGN-U224018

Score 
554
Direction 
Forward
Predicted Peptide Sequence 
MNIVFIASLILVFSNFIEASDGMDVMHISGKVLCQDCTQGWNEWVDGAKAIKGSIVSLTCLDERRRVMYYGSDLTDEAGIFDLIVNQTCH
GKTIKPQNCFVRLVSSPDPVCNIATDFAGGKSGVKLHRPTVVYRDLLKYVLSPFYYTTPMCDEPNINDDDNLETNDDKNQNNY
Predicted Coding Sequence 
ATGAATATAGTTTTTATAGCCTCATTAATTTTGGTGTTTTCTAATTTTATTGAAGCCTCAGATGGAATGGATGTTATGCATATTTCTGGC
AAAGTTCTTTGCCAAGATTGTACTCAAGGATGGAATGAATGGGTTGATGGTGCCAAAGCCATCAAAGGTAGCATCGTATCTCTGACGTGC
CTGGACGAGAGAAGAAGAGTGATGTATTACGGAAGTGACCTCACAGATGAAGCTGGAATTTTCGATTTGATTGTTAACCAAACTTGTCAT
GGCAAAACAATTAAGCCACAAAATTGCTTTGTGAGATTGGTTTCTTCACCTGATCCTGTTTGTAATATTGCCACCGACTTCGCCGGAGGA
AAATCCGGTGTAAAGCTCCACCGTCCGACGGTGGTTTACCGGGACTTGCTCAAATATGTGCTTAGCCCTTTCTACTACACAACTCCCATG
TGTGATGAACCTAATATTAATGATGATGATAATTTGGAGACTAATGATGATAAAAATCAAAACAATTATTAA\
Edits in Original Sequence 
TTTGAACAAATATTATTTAGAGAAATAAAGTGAGAATTATGAAA(5')ATGAATATAGTTTTTATAGCCTCATTAATTTTGGTGTTTTCT
AATTTTATTGAAGCCTCAGATGGAATGGATGTTATGCATATTTCTGGCAAAGTTCTTTGCCAAGATTGTACTCAAGGATGGAATGAATGG
GTTGATGGTGCCAAAGCCATCAAAGGTAGCATCGTATCTCTGACGTGCCTGGACGAGAGAAGAAGAGTGATGTATTACGGAAGTGACCTC
ACAGATGAAGCTGGAATTTTCGATTTGATTGTTAACCAAACTTGTCATGGCAAAACAATTAAGCCACAAAATTGCTTTGTGAGATTGGTT
TCTTCACCTGATCCTGTTTGTAATATTGCCACCGACTTCGCCGGAGGAAAATCCGGTGTAAAGCTCCACCGTCCGACGGTGGTTTACCGG
GACTTGCTCAAATATGTGCTTAGCCCTTTCTACTACACAACTCCCATGTGTGATGAACCTAATATTAATGATGATGATAATTTGGAGACT
AATGATGATAAAAATCAAAACAATTATTAA\(3')ATTAAGTTCTTATTTTTAATTTTTTCTTCTTCTAATGTTTGTGTTTAATTTCCCA
TTTTGTAAATGGAAAATGACAATTTATCTATGTTGGATGAGTTGATGATTTTATTTTGTACTATTAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan