ESTScan Details for Unigene SGN-U224090

Score 
619
Direction 
Forward
Predicted Peptide Sequence 
MEDVCEGKDFSFPNQEEKILQWWEEVKAFENQLEKTKNQPEYIFYDGPPFATGLPHYGHILAGTIKDIXDQVSINDGSSCDPKIWVGLHG
LPVEHEIDEKLQIKTKQQVIEMGIDKYNEECRAIVTRYVGEWEKTVVRMGRWIDFQNGYKTMDLKYMESLWWVFAKLHEKGLVYRGFKVS
P
Predicted Coding Sequence 
ATGGAAGATGTATGTGAAGGCAAAGATTTCTCTTTCCCAAATCAAGAAGAAAAAATCCTTCAATGGTGGGAAGAAGTCAAAGCATTCGAA
AACCAGCTCGAAAAGACAAAAAATCAACCCGAATACATTTTCTACGATGGTCCTCCATTTGCAACAGGTTTACCTCATTACGGCCACATA
TTAGCAGGTACAATCAAAGATATTGXTGACCAGGTATCAATCAATGACGGGTCATCATGTGACCCGAAGATTTGGGTGGGATTGCATGGA
TTACCAGTTGAACATGAAATTGATGAGAAACTTCAGATTAAGACTAAACAACAAGTGATTGAAATGGGGATTGATAAGTATAATGAGGAA
TGTAGAGCTATTGTGACAAGGTATGTTGGAGAATGGGAAAAAACTGTGGTGAGAATGGGGAGATGGATTGATTTTCAGAATGGGTATAAG
ACTATGGATTTGAAGTATATGGAGAGTCTTTGGTGGGTTTTTGCTAAGCTGCATGAAAAGGGTCTTGTTTATAGAGGCTTCAAGGTTTCT
CCT\
Edits in Original Sequence 
CTCTATCAGTGTAGCTCTTAAACCCTAGGAATTTTTTTACATCTCTCCACGCCGATTCTATCTTTCTCTCCTCTCCACTCCACATCA(5')
ATGGAAGATGTATGTGAAGGCAAAGATTTCTCTTTCCCAAATCAAGAAGAAAAAATCCTTCAATGGTGGGAAGAAGTCAAAGCATTCGA
AAACCAGCTCGAAAAGACAAAAAATCAACCCGAATACATTTTCTACGATGGTCCTCCATTTGCAACAGGTTTACCTCATTACGGCCACAT
ATTAGCAGGTACAATCAAAGATATTGXTGACCAGGTATCAATCAATGACGGGTCATCATGTGACCCGAAGATTTGGGTGGGATTGtCATG
GATTACCAGTTGAACATGAAATTGATGAGAAACTTCAGATTAAGACTAAACAACAAGTGATTGAAATGGGGATTGATAAGTATAATGAGG
AATGTAGAGCTATTGTGACAAGGTATGTTGGAGAATGGGAAAAAACTGTGGTGAGAATGGGGAGATGGATTGATTTTCAGAATGGGTATA
AGACTATGGATTTGAAGTATATGGAGAGTCTTTGGTGGGTTTTTGCTAAGCTGCATGAAAAGGGTCTTGTTTATAGAGGCTTCAAGGTTT
CTCCT\(3')TTTTTTCTTGTTCTTCAACTTGTTGTATAATTCAAGCTGATGTTAATTTACGAAGTAGTATGCCTTTTACTCAACTAAAA
GAACAGTTCACGAGCATTATGTATAATTCAAGTTAATGTTTTATTAGAAAGTAGTATGCTTTTTACTTAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan