ESTScan Details for Unigene SGN-U224210

Score 
463
Direction 
Forward
Predicted Peptide Sequence 
LSRPDEVNLHLQLHLRRVGVEARPDLIPGVPKDDSGGSSKEPNNGRKDADDSSENDKRDSETPPTESAEPPLAPEATGSHDLDNQLLKMA
KLSNDTGESVTPPSENSFFRDKQNLLVSRAILNITCEIFILNMLSLYLGNCTLTENVAAM
Predicted Coding Sequence 
XTTCTATCTAGGCCTGATGAAGTGAATCTTCATCTTCAGCTACACCTGAGACGTGTTGGTGTTGAAGCTCGACCTGACTTGATCCCTGGT
GTTCCAAAGGATGATAGTGGTGGAAGTTCCAAAGAGCCAAACAACGGAAGAAAGGATGCTGATGATTCATCAGAAAATGATAAAAGAGAC
TCAGAAACTCCTCCTACAGAAAGTGCAGAGCCCCCCTTGGCTCCAGAAGCTACCGGTTCTCACGATTTAGATAACCAACTCCTTAAGATG
GCCAAACTCTCCAATGACACAGGTGAATCTGTCACACCTCCTTCAGAAAATTCATTTTTCCGTGACAAGCAGAACTTACTAGTCTCGAGA
GCTATTCTAAACATCACTTGTGAGATTTTTATTCTTAATATGCTGTCCCTTTACTTAGGGAACTGTACATTAACTGAAAATGTAGCTGCA
ATGTAG\
Edits in Original Sequence 
(5')XTTCTATCTAGGCCTGATGAAGTGAATCTTCATCTTCAGCTACACCTGAGACGTGTTGGTGTTGAAGCTCGACCTGACTTGATCCC
TGGTGTTCCAAAGGATGATAGTGGTGGAAGTTCCAAAGAGCCAAACAACGGAAGAAAGGATGCTGATGATTCATCAGAAAATGATAAAAG
AGACTCAGAAACTCCTCCTACAGAAAGTGCAGAGCCCCCCTTGGCTCCAGAAGCTACCGGTTCTCACGATTTAGATAACCAACTCCTTAA
GATGGCCAAACTCTCCAATGACACAGGTGAATCTGTCACACCTCCTTCAGAAAATTCATTTTTCCGTGACAAGCAGAACTTACTAGTCTC
GAGAGCTATTCTAAACATCACTTGTGAGATTTTTATTCTTAATATGCTGTCCCTTTACTTAGGGAACTGTACATTAACTGAAAATGTAGC
TGCAATGTAG\(3')ACGCTTGATGGGATAGAATTTTTGTTCCTCAGTTTCTTTCTGTACATTATGGGTTGGAAAAGTGTCATTGCAAAG
ACACTATGAAATTGAAGACTCAAGTTTGTGTTGGAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan