ESTScan Details for Unigene SGN-U224214

Score 
718
Direction 
Forward
Predicted Peptide Sequence 
KPRTFIKYVAWGFPDRSLRFISYDQDRLLSTHENLHGGNQIQCASASHDGHILVTGADEGLVCVWRIGKEAPRSVRRLQLEKTLCAHTGK
ITCLQVSQPYMMIVSGSDDCTVILWDLSSMVFVRQLPQLPAPVSAIYVNDLTGNIMTAAGVMLAVWSINGDCLAVINTSQLPSDFILSLA
GCTFSDWLKLTGIFQATRVGPLKFGEWCIALAEDSGQSKPSGNPTGGLGLGDRVPEYRLILHKVLKFHKHPVTALHLTSDLKQLLSGDSG
GHLLSWTLSEEGLKSMTSRXVILGLAMCVLYSKNILGFLEGQLKDNLNGFNELREQHELVARCTVTADKIADLEQIQGNRRICVLALPGR
HEAYDXFLSKCLVAPDVGLGNKLVAYVVVDYCRGILGYWDGRLVGLLYIGR
Predicted Coding Sequence 
AAACCTAGAACATTCATTAAATATGTTGCCTGGGGTTTTCCTGACCGCAGTTTGAGATTTATTAGCTATGATCAAGATAGGCTTCTCTCC
ACTCATGAGAATCTTCATGGAGGGAACCAGATACAGTGTGCCAGTGCTAGTCATGATGGCCACATTCTAGTTACAGGGGCTGACGAGGGA
TTGGTTTGTGTTTGGAGGATTGGTAAAGAGGCACCCCGTTCTGTAAGGCGCTTGCAGTTGGAGAAGACTCTCTGTGCTCATACAGGCAAA
ATCACATGCCTACAAGTCAGTCAGCCGTACATGATGATTGTGAGTGGATCAGATGACTGCACTGTTATCTTGTGGGACCTTAGCTCCATG
GTTTTTGTTAGGCAGCTTCCTCAGTTACCCGCTCCTGTTTCAGCAATTTATGTGAATGATCTGACTGGAAACATTATGACTGCTGCTGGT
GTAATGCTTGCTGTTTGGAGCATCAATGGGGATTGCCTTGCTGTCATCAACACATCACAGCTTCCGTCGGACTTCATCCTTTCACTTGCT
GGTTGCACATTCTCGGATTGGCTGAAACTAACTGGTATATTTCAGGCCACCAGAGTGGGGCCATTAAAATTTGGAGAATGGTGCATTGCT
CTTGCXGAGGACAGTGGCCAAAGTAAACCAAGTGGGAATCCTACTGGAGGGTTAGGACTCGGGGATAGAGTACCAGAGTATAGGTTGATC
CTTCACAAGGTACTGAAGTTTCATAAGCATCCTGTAACTGCCCTCCACCTTACTAGTGATCTGAAACAGTTGTTGAGTGGAGATTCTGGA
GGACATTTGCTTTCGTGGACTCTCTCTGAAGAGGGCTTGAAAAGCATGACTAGTCGGGXGGTGATTCTGGGATTAGCAATGTGTGTTTTG
TATTCTAAAAATATACTTGGCTTCTTAGAGGGGCAATTAAAGGACAACCTGAATGGTTTCAATGAGCTCAGGGAGCAACATGAACTGGTG
GCACGTTGCACAGTAACCGCTGATAAGATTGCTGACTTGGAACAGATCCAAGGAAACAGAAGGATCTGTGTATTGGCGCTTCCTGGAAGA
CATGAAGCATATGATXCTTTCTTGAGCAAGTGCCTAGTGGCTCCAGATGTAGGACTCGGGAACAAGTTGGTTGCATATGTTGTTGTCGAT
TATTGTAGAGGGATTTTGGGGTATTGGGATGGGAGATTGGTGGGTCTGTTGTACATAGGACGGTAA\
Edits in Original Sequence 
(5')AAACCTAGAACATTCATTAAATATGTTGCCTGGGGTTTTCCTGACCGCAGTTTGAGATTTATTAGCTATGATCAAGATAGGCTTCT
CTCCACTCATGAGAATCTTCATGGAGGGAACCAGATACAGTGTGCCAGTGCTAGTCATGATGGCCACATTCTAGTTACAGGGGCTGACGA
GGGATTGGTTTGTGTTTGGAGGATTGGTAAAGAGGCACCCCGTTCTGTAAGGCGCTTGCAGTTGGAGAAGACTCTCTGTGCTCATACAGG
CAAAATCACATGCCTACAAGTCAGTCAGCCGTACATGATGATTGTGAGTGGATCAGATGACTGCACTGTTATCTTGTGGGACCTTAGCTC
CATGGTTTTTGTTAGGCAGCTTCCTCAGTTACCCGCTCCTGTTTCAGCAATTTATGTGAATGATCTGACTGGAAACATTATGACTGCTGC
TGGTGTAATGCTTGCTGTTTGGAGCATCAATGGGGATTGCCTTGCTGTCATCAACACATCACAGCTTCCGTCGGACTTCATCCTTTCACT
TGCTGGTTGCACATTCTCGGATTGGCTGcAAACTAACTGGTATATTTCAGGCCACCAGAGTGGGGCCATTAAAATTTGGAGAATGGTGCA
TTGCTCTTGCXGAGGACAGTGGCCAAAGTAAACCAAGTGGGAATCCTACTGGAGGGTTAGGACTCGGGGATAGAGTACCAGAGTATAGGT
TGATCCTTCACAAGGTACTGAAGTTTCATAAGCATCCTGTAACTGCCCTCCACCTTACTAGTGATCTGAAACAGTTGTTGAGTGGAGATT
CTGGAGGACATTTGCTTTCGTGGACTCTCTCTGAAGAGGGCTTGAAAAGCATGACTAGTCGGGXGGTGATTCTGGGATTAGCAATGTGTG
TTTTGTATTCTAAAAATATACTTGGCTTCTTAGAGGGGCAATTAAAGGACAACCTGAATGGTTTCAATGAGCTCAGGGAGCAACATGAAC
TGGTGtGCACGTTGCACAGTAACCGCTGATAAGATTGCTGACTTGGAACAGATCCAAGGAAACAGAAGGATCTGTGTATTGGCGCTTCCT
GGAAGACATGAAGCATATGATXCTTTCTTGAGCAAGTGCCTAGTGGCTCCAGATGTAGGACTCGGGAACAAGTTGGTTGCATATGTTGTT
GTCGATTATTGTAGAGGGATTTTGGGGTATTGGGATGGGAGATTGGTGGGTCTGTTGTACATAGGACGGTAA\(3')TTGACAGTGTATA
CTGAGGTTGTAAATGTGCAAGTTTTTTGCCAGTAACATCATGTTGGCTGTAATTTGATCCAGCTAACTTTAGGGGGCAGATGTAGCTGTT
CGCTTTGGCTTCACTTCGTTTAAATGATTGCAAGGGGAAGGTTGCAGGCCAAAAAAAAAGAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan