ESTScan Details for Unigene SGN-U224232

Score 
318
Direction 
Forward
Predicted Peptide Sequence 
MGILSWWKGDKNETPKTTQKPDPKPQISSDKPEVPGMNGAVEVSRPNPPPTDITVFEFGSVAASVDKVTLAGYCPVSDXARALPLGAYAG
EWVGCSSISSGFLIGVSKGKSSYGTCEEDL
Predicted Coding Sequence 
ATGGGGATTCTGTCATGGTGGAAAGGCGACAAAAATGAAACCCCTAAAACAACCCAAAAACCCGACCCGAAACCCCAAATCTCTTCCGAC
AAGCCGGAGGTTCCCGGCATGAACGGAGCTGTTGAGGTTTCCAGGCCCAACCCACCGCCGACCGACATAACCGTTTTCGAATTTGGGTCT
GTGGCTGCTTCTGTTGATAAGGTCACACTTGCCGGGTATTGTCCTGTTTCTGACGAXGCTCGAGCCTTGCCGTTGGGAGCTTATGCCGGC
GAGTGGGTCGGATGCTCCTCAATTTCGAGTGGTTTTCTGATTGGGGTAAGCAAAGGAAAGAGTTCGTATGGAACTTGTGAGGAAGATTTG
TGA\
Edits in Original Sequence 
TAAACATAAAAACTATCGAGGGTATCACAATTTAAATATAGAGGAAATCCGATTATCCGCACTACAGTGTGTAAGCAGCGAAATAGCC(5')
ATGGGGATTCTGTCATGGTGGAAAGGCGACAAAAATGAAACCCCTAAAACAACCCAAAAACCCGACCCGAAACCCCAAATCTCTTCCG
ACAAGCCGGAGGTTCCCGGCATGAACGGAGCTGTTGAGGTTTCCAGGCCCAACCCACCGCCGACCGACATAACCGTTTTCGAATTTGGGT
CTGTGGCTGCTTCTGTTGATAAGGTCACACTTGCCGGGTATTGTCCTGTTTCTGACGAXGCTCGAGCCTTGCCGTTGGGAGCTTATGCCG
GCGAGTGGGTCGGATGCTCCTCAATTTCGAGTGGTTTTCTGATTGGGGTAAGCAAAGGAAAGAGTTCGTATGGAACTTGTGAGGAAGATT
TGTGA\(3')TTTTGAGTTAAAAAGGTTCTCTTTTTTGCTGAATTTAGTGTAATTTACTGAACATGACGTAATGAAAAAACCCTAATTTA
GTTGGGAATTTACTGGTTTCATGTTCTTGATAATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAANA
ACCAGGGGGAACCAAAAACCCAACTGCGGGGGGGGGGGGCGGCCCCCCCTTCCCCCGGAGGAGGGTTTAAAAAAAAGTGGGGGGGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan