ESTScan Details for Unigene SGN-U224352

Score 
457
Direction 
Forward
Predicted Peptide Sequence 
KLDEFIPXALKNTKQTPLFLSGELDRETTVFTDTYSLLSLLGISTAEQKKGKSLIEIQLKENKGISAMHRVASAGNTSNSVRPRKEKRLT
YVLNDAGDTKHCAGVNSLAVLKSPATDGCEYLFTGSRDGTLKRWALAEDGATCSATFESHVDWVNDAVLTGSNTLVSCSSDTTVKVWNGL
SEGYCIKTLRQHSDYVTTLASAEKNSNVIASAGLGGEVFIWDLEAALTPTSKSGDATEEDCSNGVNGSGSSLPMTSIRPISSGNNISLQT
QSQVYIPVTAKGHKESVYALAMNESGSLLVSGGTEKVVRVWDPRTGSKTMKLKGHTDNX
Predicted Coding Sequence 
XXGAAACTCGATGAGTTCATCCCAAXAGCATTGAAAAACACTAAACAAACACCTCTCTTTCTCTCTGGCGAACTCGATAGAGAGACTACG
GTTTTCACCGATACTTATAGTCTTCTTTCACTCTTAGGAATCTCTACAGCXGAGCAGAAGAAGGGTAAATCGCTAATTGAAATCCAATTG
AAGGAAAATAAGGGGATTTCTGCAATGCACCGTGTAGCAAGTGCAGGGAACACGTCCAATTCGGTTCGGCCTAGGAAGGAGAAGAGGTTG
ACTTATGTTTTGAATGATGCAGGTGACACTAAGCATTGTGCAGGTGTAAATTCTTTGGCTGTATTGAAGTCACCAGCAACTGATGGATGT
GAATACCTATTCACTGGGAGCAGAGATGGCACATTAAAGAGATGGGCATTGGCTGAAGATGGTGCCACCTGCTCTGCCACATTTGAGTCA
CATGTCGATTGGGTTAATGATGCAGTTCTTACAGGTAGTAACACATTAGTATCATGCTCCTCAGACACCACTGTCAAGGTGTGGAATGGC
TTATCTGAGGGATATTGTATTAAGACACTCCGGCAGCACTCCGATTACGTCACCACCCTTGCTTCAGCAGAAAAAAATAGCAATGTTATT
GCATCTGCTGGTCTTGGTGGTGAGGTTTTCATATGGGATCTTGAAGCTGCACTTACTCCGACATCTAAGTCCGGTGATGCCACCGAAGAA
GACTGTTCAAATGGTGTCAATGGTTCAGGAAGTTCATTGCCCATGACAAGCATCCGTCCTATCAGTTCGGGCAATAACATTTCCTTGCAG
ACCCAGTCTCAAGTATATATTCCTGTGACTGCAAAAGGCCATAAGGAGTCCGTATATGCATTGGCAATGAATGAGAGTGGATCCCTTCTT
GTTTCTGGTGGTACTGAGAAGGTTGTGCGCGTTTGGGACCCAAGAACTGGTTCCAAGACCATGAAGCTAAAAGGTCATACAGATAATAXX
\
Edits in Original Sequence 
(5')XXGAAACTCGATGAGTTCATCCCAAXAGCATTGAAAAACACTAAACAAACACCTCTCTTTCTCTCTGGCGAACTCGATAGAGAGAC
TACGGTTTTaCACCGATACTTATAGTCTTCTTTCACTCTTAGGAATCTCTACAGCXGAGCAGAAGAAGGGTAAATCGCTAATTGAAATCC
AATTGAAGcGAAAATAAGGGGATTTCTGCAATGCACCGTGTAGCAAGTGCAGGGAACACGTCCAATTCGGTTCGGCCTAGGAAGGAGAAG
AGGTTGACTTATGTTTTGAATGATGCAGGTGACACTAAGCATTGTGCAGGTGTAAATTCTTTGGCTGTATTGAAGTCACCAGCAACTGAT
GGATGTGAATACCTATTCACTGGGAGCAGAGATGGCACATTAAAGAGATGGGCATTGGCTGAAGATGGTGCCACCTGCTCTGCCACATTT
GAGTCACATGTCGATTGGGTTAATGATGCAGTTCTTACAGGTAGTAACACATTAGTATCATGCTCCTCAGACACCACTGTCAAGGTGTGG
AATGGCTTATCTGAGGGATATTGTATTAAGACACTCCGGCAGCACTCCGATTACGTCACCACCCTTGCTTCAGCAGAAAAAAATAGCAAT
GTTATTGCATCTGCTGGTCTTGGTGGTGAGGTTTTCATATGGGATCTTGAAGCTGCACTTACTCCGACATCTAAGTCCGGTGATGCCACC
GAAGAAGACTGTTCAAATGGTGTCAATGGTTCAGGAAGTTCATTGCCCATGACAAGCATCCGTCCTATCAGTTCGGGCAATAACATTTCC
TTGCAGACCCAGTCTCAAGTATATATTCCTGTGACTGCAAAAGGCCATAAGGAGTCCGTATATGCATTGGCAATGAATGAGAGTGGATCC
CTTCTTGTTTCTGGTGGTACTGAGAAGGTTGTGCGCGTTTGGGACCCAAGAACTGGTTCCAAGACCATGAAGCTAAAAGGTCATACAGAT
AATAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan