ESTScan Details for Unigene SGN-U224405

Score 
1223
Direction 
Forward
Predicted Peptide Sequence 
MGKPKAVIVGGSIAGICCAHALITAGWDVVVIEKTPQPPTGSPTGAGLGIDPFSXQNHSILDSTTPTPPTNYLASRLDQNQATDGETKVS
QTLARDEHFNFRAAYWADLHSLLYGALPLDIVLWGYLFLSFSMYGDKSKVKVETKVLETGTTINFVADLLIAADGCLSSIRQHFLPDLKL
RYSGYCAWRGVLDFSKKKHSEAIINLKKVYPDLGKCLYFDLSSGTHSVFYELLNHRFNWIWYINQPEPNLKGNSVTMKVSENLVQNMHEE
AEKAWVPELVRVIKEIKEPFLNVIYDCDPLEQIFWDKVVLIGDAAHPTTPHGLRSTNMSILDAAVLGKCLEKWEVENLNSALEEYQSIXA
ASNYEAGSIFKETGRIKQGLSLSDHSSFDPKATSPEDCEELQQKNMPHFYDIPSILNDVTGFYLGRVIKAMLDA
Predicted Coding Sequence 
ATGGGGAAACCGAAAGCAGTGATTGTTGGAGGCAGCATAGCAGGTATATGCTGTGCACATGCTCTCATCACGGCTGGTTGGGATGTTGTG
GTTATTGAGAAAACTCCACAACCTCCAACTGGTAGCCCCACTGGTGCTGGCCTTGGAATTGACCCTTTCTCTXCACAAAATCATTCAATC
TTGGATTCAACAACCCCAACTCCTCCAACAAACTACCTTGCCTCTCGTCTCGATCAAAACCAGGCAACTGATGGAGAAACAAAAGTGAGC
CAGACATTGGCAAGGGATGAACATTTTAATTTCAGAGCAGCTTATTGGGCTGATCTCCATAGCCTTTTGTACGGTGCACTACCGCTAGAT
ATTGTTTTATGGGGTTATTTGTTCCTCTCCTTTTCCATGTATGGTGACAAATCAAAAGTGAAAGTCGAAACTAAAGTCCTTGAAACGGGT
ACTACAATCAACTTTGTTGCTGATTTGCTTATTGCTGCTGATGGTTGTCTGTCTTCAATCAGACAACATTTCCTTCCTGACCTTAAGCTG
AGATATTCAGGTTACTGTGCGTGGAGAGGGGTTCTTGATTTTTCCAAAAAGAAGCACTCAGAAGCCATTATCAACCTTAAGAAAGTGTAT
CCAGATCTTGGAAAATGCCTGTACTTTGACCTGAGCTCTGGAACTCATAGCGTATTTTATGAATTATTGAACCATAGGTTCAATTGGATA
TGGTACATTAATCAGCCCGAACCAAACCTCAAGGGGAATTCTGTGACGATGAAGGTTAGTGAAAACTTGGTTCAAAACATGCATGAAGAA
GCTGAAAAGGCTTGGGTTCCTGAATTGGTCAGAGTAATTAAAGAAATTAAGGAGCCTTTCCTAAATGTAATATATGATTGTGATCCTCTG
GAGCAGATTTTTTGGGACAAAGTGGTGTTGATTGGAGATGCAGCTCATCCTACTACTCCTCATGGTTTGAGAAGTACAAACATGTCGATA
CTGGATGCAGCTGTTTTAGGCAAATGCTTAGAGAAGTGGGAAGTGGAAAATCTGAACTCTGCCCTTGAAGAATACCAGTCTATTAXGGCT
GCCAGTAACTACGAAGCAGGTTCTATATTCAAGGAGACTGGTCGTATTAAACAAGGTTTATCACTTTCAGATCATTCGTCCTTTGATCCA
AAAGCTACAAGTCCAGAAGATTGTGAAGAGCTTCAGCAGAAAAACATGCCTCATTTCTACGATATTCCTTCGATATTGAATGATGTCACT
GGTTTTTATCTTGGCCGGGTTATTAAAGCAATGTTGGATGCTTAA\
Edits in Original Sequence 
CAAAGGCTTTTTTGCAGAAAAAGAGAGAAAAA(5')ATGGGGAAACCGAAAGCAGTGATTGTTGGAGGCAGCATAGCAGGTATATGCTGT
GCACATGCTCTCATCACGGCTGGTTGGGATGTTGTGGTTATTGAGAAAACTCCACAACCTCCAACTGGTAGCCCCACTGGTGCTGGCCTT
GGAATTGACCCTTTCTCTXCACAAAATCATTCAATCTTGGATTCAACAACCCCAACTCCTCCAACAAACTACCTTGCCTCTCGTCaTCGA
TCAAAACCAGGCAACTGATGGAGAAACAAAAGTGAGCCAGACATTGGCAAGGGATGAACATTTTAATTTCAGAGCAGCTTATTGGGCTGA
TCTCCATAGCCTTTTGTACGGTGCACTACCGCTAGATATTGTTTTATGGGGTTATTTGTTCCTCTCCTTTTCCATGTATGGTGACAAATC
AAAAGTGAAAGTCGAAACTAAAGTCCTTGAAACGGGTACTACAATCAACTTTGTTGCTGATTTGCTTATTGCTGCTGATGGTTGTCTGTC
TTCAATCAGACAACATTTCCTTCCTGACCTTAAGCTGAGATATTCAGGTTACTGTGCGTGGAGAGGGGTTCTTGATTTTTCCAAAAAGAA
GCACTCAGAAGCCATTATCAACCTTAAGAAAGTGTATCCAGATCTTGGAAAATGCCTGTACTTTGACCTGAGCTCTGGAACTCATAGCGT
ATTTTATGAATTATTGAACCATAGGTTCAATTGGATATGGTACATTAATCAGCCCGAACCAAACCTCAAGGGGAATTCTGTGACGATGAA
GGTTAGTGAAAACTTGGTTCAAAACATGCATGAAGAAGCTGAAAAGGCTTGGGTTCCTGAATTGGTCAGAGTAATTAAAGAAATTAAGGA
GCCTTTCCTAAATGTAATATATGATTGTGATCCTCTGGAGCAGATTTTTTGGGACAAAGTGGTGTTGATTGGAGATGCAGCTCATCCTAC
TACTCCTCATGGTTTGAGAAGTACAAACATGTCGATACTGGATGCAGCTGTTTTAGGCAAATGCTTAGAGAAGTGGGAAGTGGAAAATCT
GAACTCTGCCCTTGAAGAATACCAGTCTATTAXGGCTGCCAGTAACTACGAAGCAGGTTCTATATTCAAGGAGACTaGGTCGTATTAAAC
AAGGTTTATCACTTTCAGATCATTCGTCCTTTGATCCAAAAGCTACAAGTCCAGAAGATTGTGAAGAGCTTCAGCAGAAAAACATGCCTC
ATTTCTACGATATTCCTTCGATATTGAAcTGATGTCACTGGTTTTTATCTTGGCCGGGTTATTAAAGCAATGTTGGATGCTTAA\(3')T
TGAGACGAGCATTTTGTGTATATGTCCATCTCGCAAATGACTATTCTGGTGCACAAACATATAGCAGGCCAGTGTTATTGTTGTTGTATC
TGTATAGAAATCATGAATGTAGTATAGTGAGAATAAAGTTCATACTTGCCAGTACATAAAAAAAGGAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan