ESTScan Details for Unigene SGN-U224406

Score 
804
Direction 
Forward
Predicted Peptide Sequence 
MVSDASKKREAQKKAAAAAKRGGKSKAAVMKAAAAATSTPSESNGVDELTNGVGEIQLSDGPVPAFYVHIHFPXDIRIESLSLTFHGHDL
IVDSELELNYGRRYGLLGLNGCGKSTLLSAIGCRELPIPDHMDIFHLTREIEASDMSSLQAVISCDEERLRLEKEVEVLAAQDDGGGEQL
ERIYERLEALDASTAEKRAAEILFGLGFNKKMQEQKTRDFSGGWRMRIALARALFMNPTILLLDEPTNHLDLEACVWLEETLKKFDRILV
VVSHSQDFLNGVCTNIIHMQNKTLKLYTGNYDQYVQTREELEENQMKQYRWEREQIASMKEYIARFGHGSAKLARQAQSKEKTLA
Predicted Coding Sequence 
ATGGTGTCGGATGCGAGTAAGAAGAGAGAGGCGCAGAAGAAGGCAGCAGCAGCTGCGAAGAGAGGAGGGAAGTCTAAGGCGGCGGTGATG
AAGGCGGCAGCGGCTGCAACATCTACTCCGTCGGAGAGTAACGGTGTCGATGAATTGACGAATGGTGTAGGAGAAATTCAGTTGTCTGAT
GGACCTGTACCGGCGTTTTATGTTCACATCCACTTTCCAGXGGATATTCGGATAGAATCGTTATCACTTACTTTTCATGGACATGATCTT
ATAGTTGATTCTGAACTGGAGCTTAACTACGGAAGACGTTATGGTTTGCTTGGGCTTAATGGCTGTGGGAAGTCTACTCTTCTTTCTGCT
ATAGGATGTCGTGAACTTCCCATCCCAGATCATATGGATATCTTTCATCTAACGCGGGAGATTGAAGCGTCTGACATGTCCTCACTTCAA
GCTGTTATTAGTTGCGATGAAGAGAGGTTGAGATTGGAGAAAGAAGTTGAAGTCTTGGCTGCACAGGATGATGGTGGTGGAGAGCAACTT
GAACGCATCTATGAGCGTTTGGAAGCTTTGGACGCATCAACTGCTGAGAAGCGTGCAGCTGAAATACTGTTCGGTCTTGGATTTAACAAG
AAAATGCAAGAACAAAAAACACGAGATTTTTCCGGTGGATGGAGGATGAGGATTGCTCTTGCTCGTGCCCTGTTTATGAATCCGACCATT
TTGCTGCTTGATGAACCCACCAATCATCTAGACCTAGAGGCTTGCGTGTGGTTAGAAGAAACCTTGAAGAAGTTTGACCGTATTCTGGTT
GTTGTTTCACACTCGCAAGACTTCCTAAATGGTGTGTGTACTAACATCATCCATATGCAAAATAAGACGTTGAAGCTCTACACTGGTAAT
TATGATCAATATGTCCAAACCCGTGAGGAGTTGGAAGAAAATCAGATGAAACAGTACAGATGGGAGCGGGAGCAGATTGCTTCAATGAAG
GAGTACATTGCTCGTTTTGGACATGGATCTGCCAAACTAGCCCGTCAAGCACAAAGTAAAGAGAAAACACTGGCX\
Edits in Original Sequence 
ACATCTGATTATTGCAACTTTTTTCCAGGTTATTTTTTTGGATTAAATTGCATATTATTGTAGTTTTTGCTTTCTGATCGGAGAGTTTTT
CTTTTCTTTTCTGAATTGATAG
(5')ATGGTGTCGGATGCGAGTAAGAAGAGAGAGGCGCAGAAGAAGGCAGCAGCAGCTGCGAAGAGAG
GAGGGAAGTCTAAGGCGGCGGTGATGAAGGCGGCAGCGGCTGCAACATCTACTCCGTCGGAGAGTAACGGTGTCGATGAATTGACGAATG
GTGTAGGAGAAATTCAGTTGTCTGATcGGACCTGTACCGGCGTTTTATGTTCACATCCACTTTCCAGXGGATATTCGGATAGAATCGTTA
TCACTTACTTTTCATGGACATGATCTTATAGTTGATTCTGAACTGGAGCTTAACTACGGAAGACGTTATGGTTTGCTTGGGCTTAATGGC
TGTGGGAAGTCTACTCTTCTTTCTGCTATAGGATGTCGTGAACTTCCCATCCCAGATCATATGGATATCTTTCATCTAACGCGGGAGATT
GAAGCGTCTGACATGTCCTCACTTCAAGCTGTTATTAGTTGCGATGAAGAGAGGTTGAGATTGGAGAAAGAAGTTGAAGTCTTGGCTGCA
CAGGATGATGGTGGTGGAGAGCAACTTGAACGCATCTATGAGCGTTTGGAAGCTTTGGACGCATCAACTGCTGAGAAGCGTGCAGCTGAA
ATACTGTTCGGTCTTGGATTTAACAAGAAAATGCAAGAACAAAAAACACGAGATTTTTCCGGTGGATGGAGGATGAGGATTGCTCTTGCT
CGTGCCCTGTTTATGAATCCGACCATTTTGCTGCTTGATGAACCCACCAATCATCTAGACCTAGAGGCTTGCGTGTGGTTAGAAGAAACC
TTGAAGAAGTTTGACCGTATTCTGGTTGTTGTTTCACACTCGCAAGACTTCCTAAATGGTGTGTGTACTAACATCATCCATATGCAAAAT
AAGACGTTGAAGCTCTACACTGGTAATTATGATCAATATGTCCAAACCCGTGAGGAGTTGGAAGAAAATCAGATGAAACAGTACAGATGG
GAGCGGGAGCAGATTGCTTCAATGAAGGAGTACATTGCTCGTTTTGGACATGGATCTGCCAAACTAGCCCGTCAAGCACAAAGTAAAGAG
AAAACACTGGCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan