ESTScan Details for Unigene SGN-U224470

Score 
122
Direction 
Forward
Predicted Peptide Sequence 
TPWLDNKHTVFGRVVKGMDVVQSLEKVKTDKGDKPYQDVKILNVTVPKLKWVLVVAXAPYWIVYICFILENWKEYYDFTLESIAILVGP
Predicted Coding Sequence 
ACTCCATGGTTGGACAATAAGCACACAGTTTTTGGCAGAGTGGTGAAAGGAATGGATGTTGTACAGTCTTTAGAGAAAGTGAAGACCGAC
AAAGGTGACAAGCCATACCAGGATGTAAAAATATTGAATGTGACTGTTCCAAAGCTTAAATGGGTTCTTGTTGTGGCTXATGCTCCTTAT
TGGATAGTTTACATCTGCTTTATTCTGGAGAACTGGAAGGAGTACTACGACTTTACGTTGGAAAGTATTGCTATCCTCGTTGGACCCTGA
\
Edits in Original Sequence 
(5')ACTCCATGGTTGGACAATAAGCACACAGTTTTTGGCAGAGTGGTGAAAGGAATGGATGTTGTACAGTCTTTAGAGAAAGTGAAGAC
CGACAAAGGTGACAAGCCATACCAGGATGTAAAAATATTGAATGTGACTGTTCCAAAGtCTTAAATGGGTTCTTGTTGTGGCTXATGCTC
CTTATTGGATAGTTTACATCTGCTTTATTCTGGAGAACTGGAAGGAGTACTACGACTTTACGTTGGAAAGTATTGCTATCCTCGTTGGAC
CCTGA\(3')TCTGACATGTATCTGTGTAATCTATGACTTCTGGTACTTTTCTCAAAACCTGCTATACAACATAGATTCCTTCAGTTTTA
AGAAACTTTTCGTGCCTCCGGGAAGTAGAATTCCACTTGCTTCACTCAAGTTGAAAGGATATTAGTGAATGGGAGTTGCTGGCTGATCTG
GTATTAGGATTAGCTCATTGCCACAAGGAGTGTACGATCAGCGTTTTCCACTCAAGATTCATTAGTGAGACAGAACGGCCTAGCTTATTA
TCAATGTTCATGTTGTGGACAGTAATTTATAGAGTTAGAGACCTAGATGTTGTTTTCGCGGTTTCAACTGAACTACAACAAGTGTAGACC
TTTTTGACATCTTTTTAAGTCCTAGCTTCATATATTTGAATTGTAGCTGCAGTTACTGTACAAGACCCTATTATGAATTCAAATTATCAG
TAAGCTTCATTTCACTTCTCAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan