ESTScan Details for Unigene SGN-U224503

Score 
909
Direction 
Forward
Predicted Peptide Sequence 
NEAAMRNDVKAIVLTGYGGRFSGGFDINVFEKVHKTDDVSLLPDVSVDLVTNIMEDGKKPAVAVVEGLCLGGGLELALGCHARIAAPRTQ
LGLPELSLGVLPGSGGTQRLPRLIGLSKAIDMMMTSKPIMSEEGEKLGLIDAVVPSKELLKVARQWALDIAERRKPWMRALHRTDKIGSL
SEAHEVLKLARKQVKQTARNMPQHLACLDVIEEGIVHGGYNGILKEAKVFEDLVLSDTSRGLVHVFFAQRATSKVPNVTDIGLKPRSVKK
V
Predicted Coding Sequence 
AATGAAGCAGCTATGAGAAATGATGTCAAAGCTATTGTTCTGACTGGATATGGTGGGCGGTTTTCTGGTGGTTTTGACATCAATGTTTTC
GAAAAGGTTCATAAAACAGATGATGTTTCTCTATTGCCTGATGTTTCTGTTGATCTCGTGACGAACATTATGGAAGATGGAAAGAAGCCT
GCAGTGGCTGTTGTGGAAGGACTTTGTCTTGGAGGTGGCTTGGAATTGGCATTGGGATGCCATGCACGCATTGCTGCGCCAAGAACACAA
CTTGGGTTGCCAGAGCTTAGCCTTGGAGTTCTTCCTGGCTCTGGAGGTACACAACGACTTCCAAGGCTTATAGGGTTGTCAAAGGCTATT
GATATGATGATGACATCCAAACCAATAATGTCAGAAGAGGGGGAGAAGCTAGGTCTTATTGATGCAGTTGTCCCTTCCAAAGAGTTGTTA
AAAGTAGCTAGACAGTGGGCCCTTGATATTGCAGAAAGGCGCAAACCTTGGATGCGTGCCCTTCACAGGACTGACAAAATTGGTTCCCTT
TCAGAAGCACATGAAGTTCTGAAGTTGGCTAGGAAACAAGTGAAGCAAACTGCTCGGAATATGCCTCAGCACTTGGCATGCCTTGATGTA
ATTGAAGAAGGCATAGTCCATGGTGGATATAATGGGATTCTCAAGGAAGCTAAAGTTTTTGAGGACCTTGTATTATCAGATACATCAAGA
GGTCTTGTTCACGTATTTTTTGCCCAACGGGCTACATCAAAGGTACCTAATGTAACTGATATTGGTCTGAAACCAAGGTCAGTGAAGAAA
GTT\
Edits in Original Sequence 
(5')AATGAAGCAGCTATGAGAAATGATGTCAAAGCTATTGTTCTGACTGGATATGGTGGGCGGTTTTCTGGTGGTTTTGACATCAATGT
TTTCGAAAAGGTTCATAAAACAGATGATGTTTCTCTATTGCCTGATGTTTCTGTTGATCTCGTGACGAACATTATGGAAGATGGAAAGAA
GCCTGCAGTGGCTGTTGTGGAAGGACTTTGTCTTGGAGGTGGCTTGGAATTGGCATTGGGATGCCATGCACGCATTGCTGCGCCAAGAAC
ACAACTTGGGTTGCCAGAGCTTAGCCTTGGAGTTCTTCCTGGCTCTGGAGGTACACAACGACTTCCAAGGCTTATAGGGTTGTCAAAGGC
TATTGATATGATGATGACATCCAAACCAATAATGTCAGAAGAGGGGGAGAAGCTAGGTCTTATTGATGCAGTTGTCCCTTCCAAAGAGTT
GTTAAAAGTAGCTAGACAGTGGGCCCTTGATATTGCAGAAAGGCGCAAACCTTGGATGCGTGCCCTTCACAGGACTGACAAAATTGGTTC
CCTTTCAGAAGCACATGAAGTTCTGAAGTTGGCTAGGAAACAAGTGAAGCAAACTGCTCGGAATATGCCTCAGCACTTGGCATGCCTTGA
TGTAATTGAAGAAGGCATAGTCCATGGTGGATATAATGGGATTCTCAAGGAAGCTAAAGTTTTTGAGGACCTTGTATTATCAGATACATC
AAGAGGTCTTGTTCACGTATTTTTTGCCCAACGGGCTACATCAAAGGTACCTAATGTAACTGATATTGGTCTGAAACCAAGGTCAGTGAA
GAAAGTT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan