ESTScan Details for Unigene SGN-U224581

Score 
82
Direction 
Reverse
Predicted Peptide Sequence 
MTINDRHYKAPPIHYCQSDFYHPRDLLLHHHHYFRLHLRINAQANNFHVNAINTHKILQPVFYGTQPPRCALWYKPSSRHTPNPTPENGH
LTPSSTSNSFVIKHALVFDLINPPNTPLKTPKSSXPIADFVLTGSLTYNKSVLHLLIKKLRPDVFENREDFMK
Predicted Coding Sequence 
ATGACGATCAATGATCGCCATTACAAGGCCCCACCTATTCATTACTGCCAATCTGATTTCTATCATCCTCGCGATCTTCTTCTTCATCAT
CATCATTATTTTCGTCTTCATCTGAGGATAAATGCACAAGCCAACAACTTCCATGTAAATGCCATTAACACACACAAAATACTCCAACCC
GTTTTCTATGGTACCCAGCCTCCGCGCTGCGCTCTTTGGTATAAGCCTAGCAGCCGTCATACTCCAAACCCTACCCCCGAAAACGGACAC
CTCACTCCTTCTTCAACCTCCAATTCTTTCGTAATCAAACACGCCCTCGTCTTCGATCTCATAAATCCCCCAAATACCCCTCTGAAAACC
CCTAAATCATCAXCTCCTATCGCTGATTTCGTGCTCACAGGATCACTAACGTACAATAAATCCGTTCTACATCTCCTCATTAAGAAACTC
CGACCCGACGTCTTCGAAAATCGAGAAGATTTCATGAAATGA\
Edits in Original Sequence 
GGGCCCCCCTCGAGTTTTTTTTTTTCTTTTTTTTTTTTTTTTTTTTTTTAGCGTGAACACCGAATAAGTTTCACCGATTTAATTGTTTAC
TCTTTGGTACAATCAGCTGTTCCTCTCTTGGTGTTTGGTTTGTTGAGAAATGTTTCTACAAAAAAAGAACTTTCTGAAACTCTTCTCAAA
ATTTTCAAAACAAACCAAACATCAGTTAAAGTAAATCCATATCACTCTGTTTCTTCCTTCCTGTCCCTGACTCTCATCTTCAGGGACGGG
ACGGAATTT
(5')ATGACGATCAATGATCGCCATTACAtAGGCCCCACCTATTCATTACTGCCAATCTGATTTCTATCATCCTCGCGATC
TTCTTCTTCATCATCATCATTATTTTCGTCTTCATCTGAGGATAAATGCACAAGCCAACAACTTCCATGTAAATGcCCATTAACACACAC
AAAATACTCCAACCCGTTTTCTATGGTACCCAGCCTCCGCGCTGCGCTCTTTGGTATAAGCCTAGCAGCCGTCATACTCCAAACCCTACC
CCCGcAAAACGGACACCTCACTCCTTCTTCAACCTCCAATTCTTTCGTAATCAAACACGCCCTCGTCTTCGATCTCATAAATCCCCCAAA
TACCCCTCTGAAAACCCCTAAATCATCAXCTCCTATCGCTGATTTCGTGCTCACAcGGATCACTAACGTACAATAAATCCGTTCTACATC
TCCTCATTAAGAAACTCCGACCCGACGTCTTCGAAAATCGAGAAGATTTCATGAAATGA\(3')CCCGGATATGATTGACCCGTTCGAAA
ATGTCGGGTCGGATTACACCCGCAGCAGTAAAACAACAATTTCGCCATAGCTTCCCATTCCCCTCCGATCCGACCATTCGGCGCACCCTC
CATTAACGACGCTATCATGCGCGGTGCGCGATAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan