ESTScan Details for Unigene SGN-U224665

Score 
466
Direction 
Forward
Predicted Peptide Sequence 
MELKKERFVRFYSGEKQQGSFLGGIADSSNVEKKFSPPLLNSDGKYKVADTLKFGRPKKVYPEDHESWRKRILDPGSDLVIQWNRIFIIS
CLLALFVDPLYFFLPIIQGTKESSCVKTDLNLRIVVTIFRTIADFFYLLHVFIKFRTAYVAPNTRVFGKGELVMDPGEIARRYLKSDFFI
DLIATLPLPQIVIWFIIPATRSQHANHNNNALALIVLIQYIPRLYLIFPLSSQIIKATGVVTKTAWAGAAYNLLLYMLARHVIGAAWVYW
QLIDILLAGNQYAERKTALXQRVLRYLDCDTFDLX
Predicted Coding Sequence 
ATGGAGCTGAAGAAGGAGAGGTTTGTAAGGTTCTACTCTGGTGAAAAGCAACAAGGTAGTTTTTTGGGAGGAATAGCAGACAGTTCGAAC
GTAGAGAAAAAATTCTCACCTCCATTATTGAACTCTGATGGAAAATATAAAGTCGCTGATACTCTTAAGTTTGGGAGGCCGAAGAAGGTG
TATCCCGAGGACCATGAGTCCTGGAGGAAGCGAATACTTGATCCGGGGAGTGACCTTGTAATCCAGTGGAATAGAATTTTTATTATATCA
TGCTTGCTGGCACTGTTTGTTGATCCATTGTATTTCTTTTTGCCCATCATACAAGGGACGAAAGAGTCGAGTTGTGTGAAAACAGATTTG
AATTTGCGAATTGTTGTCACCATTTTCCGAACTATAGCGGATTTTTTCTATCTATTGCATGTGTTCATTAAGTTCCGGACTGCTTATGTT
GCCCCAAATACAAGGGTATTTGGGAAGGGTGAGCTTGTAATGGATCCTGGAGAAATTGCTCGAAGATATTTAAAATCCGACTTTTTCATA
GATCTGATTGCCACTCTTCCTCTACCTCAGATAGTCATCTGGTTCATTATACCAGCGACGAGAAGCCAGCATGCTAATCATAACAATAAT
GCTCTTGCACTGATTGTCCTAATCCAATACATCCCCAGATTGTATCTTATATTTCCACTAAGTTCACAGATAATCAAAGCTACTGGAGTT
GTCACAAAAACTGCTTGGGCAGGGGCTGCATATAATCTACTTCTCTACATGTTGGCAAGGCATGTTATAGGTGCAGCATGGGTTTACTGG
CAGTTGATCGATATACTTCTTGCTGGAAATCAATATGCCGAAAGGAAGACAGCTCTACXGCAGCGTGTGCTTCGCTACTTGGATTGTGAT
ACTTTTGACCTAAXX\
Edits in Original Sequence 
TTTTCTGAAGACTTGTTTTGTGTTCACATTGGGAAGATATGAAAGGGTAAAGGGGGTTAAAAAAAGCATATTCTTGATTATTTTTTTGGT
TACCCTTCTTGGA
(5')ATGGAGCTGAAGAAGGAGAGGTTTGTAAGGTTCTACTCTGGTGAAAAGCAACAAGGTAGTTTTTTGGGAGGAA
TAGCAGACAGTTCGAACGTAGAGAAAAAATTCTCACCTCCATTATTGAACTCTGATGGAAAATATAAAGTCGCTGATACTCTTAAGTTTG
GGAGGCCGAAGAAGGTGTATCCCGAGGACCATGAGTCCTGGAGGAAGCGAATACTTGATCCGGGGAGTGACCTTGTAATCCAGTGGAATA
GAATTTTTATTATATCATGCTTGCTGGCACTGTTTGTTGATCCATTGTATTTCTTTTTGCCCATCATACAAGGGACGAAAGAGTCGAGTT
GTGTGAAAACAGATTTGAATTTGCGAATTGTTGTCACCATTTTCCGAACTATAGCGGATTTTTTCTATCTATTGCATGTGTTCATTAAGT
TCCGGACTGCTTATGTTGCCCCAAATACAAGGGTATTTGGGAAGGGTGAGCTTGTAATGGATCCTGGAGAAATTGCTCGAAGATATTTAA
AATCCGACTTTTTCATAGATCTGATTGCCACTCTTCCTCTACCTCAGATAGTCATCTGGTTCATTATACCAGCGACGAGAAGCCAGCATG
CTAATCATAACAATAATGCTCTTGCACTGATTGTCCTAATCCAATACATCCCCAGATTGTATCTTATATTTCCACTAAGTTCACAGATAA
TCAAAGCTACTGGAGTTGTCACAAAAACTGCTTGGGCAGGGGCTGCATATAATCTACTTCTCTACATGTTGGCAAGGCATGTTATAGGTG
CAGCATGGGaTTTACTGGCAGTTGATCGATATACTTCTTGCTGGAAATCAATATGCCGAAAGGAAGACAGCTCTACXGCAGCGTGTGCTT
CGCTACTTGGATTGTGATACTTTTGACCTAAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan