ESTScan Details for Unigene SGN-U224766

Score 
560
Direction 
Forward
Predicted Peptide Sequence 
MGIKGLMKLLADNAPSGMKEQKFESYFGRKIAIDASMSIYQFLIVVGRSGTEMLTNEAGETTSHLVGDVFAAIRLLEAGIKPVYVFDGKP
PDLKKQELAKRYSRREDATDDLAKATESGNKEDIEKFSKRTVKVTSQHNDDCKKLLRLMGVPAVEAPSEAEAQCAALCKAEKVYAEASED
MDSLTFGAPKFLRHLMDPSSKEIPVMEFDISWYWRDLNLVWIRSX
Predicted Coding Sequence 
ATGGGAATCAAGGGTTTAATGAAGCTGTTGGCTGACAATGCTCCAAGTGGAATGAAGGAGCAGAAGTTCGAGAGCTATTTCGGCCGTAAA
ATAGCCATCGACGCTAGTATGAGCATTTATCAGTTCCTGATTGTAGTAGGACGAAGCGGTACGGAAATGCTCACTAACGAAGCTGGGGAA
ACTACTAGTCATTTGGTCGGXGATGTTTTCGCGGCGATTAGGCTTTTGGAAGCTGGAATCAAGCCAGTTTATGTTTTTGATGGCAAGCCC
CCTGATTTGAAGAAACAAGAACTTGCAAAACGTTACTCTAGAAGGGAAGATGCCACAGATGACTTGGCTAAGGCTACAGAGAGTGGCAAC
AAGGAGGATATTGAGAAATTCAGCAAGAGAACAGTAAAGGTTACATCACAACACAATGATGACTGCAAAAAACTTCTCAGACTAATGGGG
GTACCTGCTGTTGAGGCTCCTTCTGAAGCAGAGGCTCAGTGTGCTGCACTTTGCAAGGCAGAAAAGGTTTATGCTGAGGCCTCAGAAGAT
ATGGATTCCTTAACTTTTGGAGCTCCAAAGTTTCTTCGCCATTTAATGGATCCTAGCTCCAAAGAGATACCAGTGATGGAATTTGACATC
TCCTGGTATTGGAGGGACTTGAACTTAGTATGGATCAGGTCATXX\
Edits in Original Sequence 
AAAACTTAAACTCTAGTACCCAACCTTCAAGAAATTGGCTGAAGCTTTCTGAGTTCGTTCTATCCAAAAA(5')ATGGGAATCAAGGGTT
TAATGAAGCTGTTGGCTGACAATGCTCCAAGTGGAATGAAGGAGCAGAAGTTCGAGAGCTATTTCGGCCGTAAAATAGCCATCGACGCTA
GTATGAGCATTTATCAGTTCCTGATTGTAGTAGGACGAAGCGGTACGGAAATGCTCACTAACGAAGCTGGGGAAACTACTAGTCATTTGG
TCGGXGATGTTTTCGCGGaCGATTAGGCTTTTGGAAGCTGGAATCAAGCCAGTTTATGTTTTTGATGGCAAGCCCCCTGATTTGAAGAAA
CAAGAACTTGCAAAACGTTACTCTAGAAGGGAAGATGCCACAGATGACTTGGCTAAGGCTACAGAGAGTGGCAACAAGGAGGATATTGAG
AAATTCAGCAAGAGAACAGTAAAGGTTACATCACAACACAATGATGACTGCAAAAAACTTCTCAGACTAATGGGGGTACCTGCTGTTGAG
GCTCCTTCTGAAGCAGAGGCTCAGTGTGCTGCACTTTGCAAGGCAGAAAAGGTTTATGCTGAGGCCTCAGAAGATATGGATTCCTTAACT
TTTGGAGCTCCAAAGTTTCTTCGCCATTTAATGGATCCTAGCTCCAAAGAGATACCAGTGATGGAATTTGACATCTCCTaGGTATTGGAG
GGACTTGAACTTAGTATGGATCAGGTCATXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan