ESTScan Details for Unigene SGN-U224788

Score 
602
Direction 
Forward
Predicted Peptide Sequence 
SWCPHNVGKRSDASFDWERSSLLSNRMRLFCSRLNRASSSLRARIKPKTCSGGLVLAVIFIVTVVLMCTGVKYIYGGSGAEEAYPLNGQY
SQFTLLTMTYDARLWNLKMYVKHYSRCSSVREIVVVWNKGQPPELSELDSAVPVRIRVEKQISLNNRFKVDPLIKTRAVLELDDDIMMPC
DDVERGFKVWREYPERIVGFYPRLADGNPLKYRAENHAREHNGYNMILTGAAFMDSKMAFEKYWSNEAAAGRAVVDKLFNCEDVLLNYLY
ANASSSSTVEYVKPAWAIDTSKFSGVAISRNXTDSLWTQKQLPPKVLRNVWKYX
Predicted Coding Sequence 
XTAAGTTGGTGCCCTCACAATGTTGGAAAGAGGAGTGACGCTTCGTTCGATTGGGAAAGATCAAGCTTGTTATCTAATAGAATGAGGCTA
TTTTGTAGTCGGTTGAACAGAGCAAGCTCGTCTCTCCGTGCCAGAATAAAGCCTAAAACATGCAGTGGAGGATTGGTTCTTGCTGTAATC
TTTATAGTCACTGTGGTGTTAATGTGCACTGGAGTTAAATACATCTATGGAGGCAGCGGTGCAGAGGAAGCTTACCCGTTAAATGGTCAG
TACTCTCAGTTCACTTTATTAACAATGACCTACGATGCTCGGCTCTGGAACTTGAAAATGTATGTCAAGCATTACTCAAGGTGTTCTTCA
GTACGTGAGATCGTTGTAGTGTGGAATAAAGGCCAACCTCCAGAACTGAGTGAGCTCGATTCAGCAGTGCCAGTGAGGATAAGAGTAGAG
AAACAGATCTCACTAAACAATCGATTCAAAGTAGATCCTTTGATAAAGACACGAGCAGTTCTTGAACTTGATGATGACATTATGATGCCT
TGTGATGATGTTGAAAGGGGATTTAAGGTATGGCGTGAGTACCCTGAACGCATCGTTGGGTTTTACCCCCGGCTTGCAGATGGAAACCCA
TTGAAATATAGAGCTGAGAATCATGCTCGCGAGCACAATGGATACAACATGATTCTTACAGGAGCTGCCTTCATGGACAGCAAAATGGCT
TTCGAAAAGTACTGGAGCAATGAAGCTGCAGCAGGAAGGGCCGTGGTGGACAAGCTTTTCAACTGTGAAGATGTGTTGCTAAACTACTTG
TATGCAAACGCGAGCTCCTCCAGTACAGTTGAATACGTAAAACCAGCATGGGCAATCGATACTTCAAAGTTTTCTGGCGTTGCAATTAGC
CGGAATXACACAGACTCACTATGGACTCAGAAGCAGTTGCCTCCAAAAGTTCTCAGAAATGTATGGAAGTATAXX\
Edits in Original Sequence 
(5')XTAAGTTGGTGCCCTCACAATGTTGGAAAGAGGAGTGACGCTTCGTTCGATTGGGAAAGATCAAGCTTGTTATCTAATAGAATGAG
GCTATTTTGTAGTCGGTTGAACAGAGCAAGCTCGTCTCTCCGTGCCAGAATAAAGCCTAAAACATGCAGTGGAGGATTGGTTCTTGCTGT
AATCTTTATAGTCACTGTGGTGTTAATGTGCACTGGAGTTAAATACATCTATGGAGGCAGCGGTGCAGAGGAAGCTTACCCGTTAAATGG
TCAGTACTCTCAGTTCACTTTATTAACAATGACCTACGATGCTCGGCTCTGGAACTTGAAAATGTATGTCAAGCATTACTCAAGGTGTTC
TTCAGTACGTGAGATCGTTGTAGTGTGGAATAAAGGCCAACCTCCAGAACTGAGTGAGCTCGATTCAGCAGTGCCAGTGAGGATAAGAGT
AGAGAAACAGATCTCACTAAACAATCGATTCAAAGTAGATCCTTTGATAAAGACACGAGCAGTTCTTGAACTTGATGATGACATTATGAT
GCCTTGTGATGATGTTGAAAGGGGATTTAAGGTATGGCGTGAGTACCCTGAACGCATCGTTGGGTTTTACCCCCGGCTTGCAGATGGAAA
CCCATTGAAATATAGAGCTGAGAATCATGCTCGCGAGCACAATGGATACAACATGATTCTTACAGGAGCTGCCTTCATGGACAGCAAAAT
GGCTTTCGAAAAGTACTGGAGCAATGAAGCTGCAGCAGGAAGGGCCGTGGTGGACAAGCTTTTCAACTGTGAAGATGTGTTGCTAAACTA
CTTGTATGCAAACGCGAGCTCCTCCAGTACAGTTGAATACGTAAAACCAGCATGGGCAATCGATACTTCAAAGTTTTCTGGCGTTGCAAT
TAGCCGGAATXACACAGACTCACTATGGACTCAGAAGCAGTTGCCTCCAAAAGTTCTCAGAAATGTATGGAAGTATAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan