ESTScan Details for Unigene SGN-U224795

Score 
748
Direction 
Forward
Predicted Peptide Sequence 
MAASLSSLFLSNPRPFRPPINPKSNPHLVFPLRTLNFSAKPNPPPPNSNAKQPPTIRXTAVLRRGSSLVNGSNEEPAGVTMFKDDEESES
YFLKRRKEGIASVVEDPVQPEVVWEQTEKDVEAEKSLKTVTSPGFSFSAAGLLFPYHLGVAKLLIEKGYIKETTPLAGSSAGAIVCVVVA
SGASMQEALDATKILAQDCRLKGTAFRLGAVLREVLEKFLPDDAHIRCNGRVRVAXNTDTLEAQRLVVDQFDSKEDLINAVFTSSFIPGY
TFLLALLVSLLAQALTKPSKYHESRYLAPRPATFFRNRLCIDGGLTLFMPPTSAAQTVIC
Predicted Coding Sequence 
ATGGCTGCTTCACTATCTTCCCTTTTCCTCTCAAACCCTCGTCCTTTTCGCCCTCCTATAAACCCTAAATCTAATCCCCATCTCGTTTTT
CCACTTCGTACCCTCAATTTCTCCGCTAAACCTAACCCACCCCCTCCGAACTCCAATGCAAAACAACCACCCACCATCAGAGXAACCGCC
GTTTTGAGGCGTGGAAGTAGTTTAGTTAATGGGTCGAATGAGGAGCCGGCTGGTGTGACTATGTTCAAGGATGATGAAGAGAGTGAGTCT
TACTTTTTGAAAAGGAGGAAGGAAGGGATAGCGTCGGTGGTTGAGGACCCTGTTCAGCCGGAGGTTGTGTGGGAGCAGACGGAGAAGGAT
GTGGAAGCTGAGAAGAGCTTGAAAACGGTGACTAGCCCTGGGTTTAGCTTCTCTGCTGCTGGGCTTTTGTTTCCCTATCATCTTGGGGTT
GCTAAGCTTCTCATTGAGAAGGGCTATATCAAGGAGACAACACCACTAGCTGGTTCGTCTGCTGGTGCAATTGTCTGTGTAGTGGTTGCT
TCTGGTGCCAGTATGCAAGAGGCTCTAGATGCTACGAAAATATTAGCTCAAGATTGTCGGCTCAAAGGGACAGCATTTCGCCTTGGGGCT
GTTCTTAGAGAAGTTCTAGAGAAATTTCTTCCAGATGATGCTCATATTAGATGCAATGGAAGAGTTCGTGTTGCTGXTAACACAGATACT
TTGGAGGCCCAGAGGCTTGTTGTTGATCAGTTTGATTCAAAGGAAGATCTTATCAATGCTGTCTTTACTTCTTCGTTTATCCCAGGGTAC
ACTTTCCTTCTGGCTTTATTAGTTTCTCTTTTAGCTCAAGCTTTAACTAAACCTTCAAAGTATCATGAATCAAGATATCTTGCTCCGAGA
CCAGCCACGTTTTTCAGGAATAGATTGTGTATTGATGGGGGGCTGACACTGTTTATGCCGCCGACATCTGCTGCTCAGACGGTAATTTGT
TAA\
Edits in Original Sequence 
AAAGAAATACAAATACATATGAAACATATTACCCATCAAAAATCATCATCTTCTTCTTCTCAACCTAACAAATCA(5')ATGGCTGCTTC
ACTATCTTCCCTTTTCCTCTCAAACCCTCGTCCTTTTCGCCCTCCTATAAACCCTAAATCTAATCCCCATCTCGTTTTTCCACTTCGTAC
CCTCAATTTCTCCGCTAAACCTAACCCACCCCCTCCGAACTCCAATGCAAAACAACCACCCACCATCAGAGXAACCGCCGTTTTGAGGCG
TGGAAGTAGTTTAGTTAATGGGTCGAATGAGGAGCCGGCTGGTGTGACTATGTTCAAGGATGATGAAGAGAGTGAGTCTTACTTTTTGAA
AAGGAGGAAGGAAGGGATAGCGTCGGTGGTTGAGGACCCTGTTCAGCCGGAGGTTGTGTGGGAGCAGACGGAGAAGGATGTGGAAGCTGA
GAAGAGCTTGAAAACGGTGACTAGCCCTGGGTTTAGCTTCTCTGCTGCTGGGCTTTTGTTTCCCTATCATCTTGGGGTTGCTAAGCTTCT
CATTGAGAAGGGCTATATCAAGGAGACAACACCACTAGCTGGTTCGTCTGCTGGTGCAATTGTCTGTGTAGTGGTTGCTTCTGGTGCCAG
TATGCAAGAGGCTCTAGATGCTACGAAAATATTAGCTCAAGATTGTCGGCTCAAAGGGACAGCATTTCGCCTTGGGGCTGTTCTTAGAGA
AGTTCTAGAGAAATTTCTTCCAGATGATGCTCATATTAGATGCAATGGAAGAGTTCGTGTTGCTGXTAACACAGATACTTTGGAGGCCCA
GAGGCTTGTTgGTTGATCAGTTTGATTCAAAGGAAGATCTTATCAATGCTGTCTTTACTTCTTCGTTTATCCCAGGGTACACTTTCCTTC
TGGCTTTATTAGTTTCTCTTTTAGCTCAAGCTTTAAtCTAAACCTTCAAAGTATCATGAATCAcAGATATCTTGCTCCGAGACCAGCCAC
GTTTTTCAGGAATAGATTGTGTATTGATGGGGGGCTGACACTGTTTATGCCGCCGACATCTGCTGCTCAGACGGTAATTTGTTAA\(3')
GAAATTAGTCAAATAGTCTGCTGTCATTTGTGGATGCTAGTTGTAGGTTGAATTTGCTATTGTATGTCCTGTGCTTTGAAATAATTTGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan