Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U224915

Score 
555
Direction 
Forward
Predicted Peptide Sequence 
KRLLSWYSKLIFNVQAATKKLKKFSXKFPQIRDQVYDEKGNTVTITVVCCNPEKLRDKLCCKGCGVIKSIEIKDPPKPKPPEKPKEPEKP
KPEKPKEPEKPKVVVIEKPKEPEKPKVVVTEKPKEPEKPKIVIIKEPQKPKTPEKPKEVEKPKPKEPEKPKEVPKPKPEPEKPKEVPKPK
PEXRNANANASANSRIPTTATTDIVVDNATGGQTGGPCYQGYGRSAPPPPETVVDNAX
Predicted Coding Sequence 
AAAAGACTACTATCATGGTACTCAAAGTTGATCTTCAATGTTCAAGCTGCTACAAAAAAGTTAAAAAAATTCTCTGXTAAATTCCCTCAA
ATTAGAGATCAAGTATATGATGAGAAGGGCAATACAGTCACAATCACTGTTGTTTGTTGTAATCCTGAAAAACTTCGTGACAAATTGTGT
TGTAAAGGATGTGGAGTAATCAAAAGCATTGAAATCAAAGACCCTCCAAAGCCCAAACCTCCCGAAAAGCCCAAAGAGCCCGAAAAGCCC
AAACCTGAAAAGCCTAAAGAGCCCGAAAAACCTAAAGTTGTCGTCATTGAAAAGCCCAAGGAGCCTGAGAAGCCTAAGGTTGTCGTTACT
GAAAAACCTAAAGAACCTGAGAAGCCTAAGATTGTTATCATTAAAGAGCCTCAGAAACCTAAGACACCTGAAAAGCCAAAAGAAGTTGAG
AAGCCTAAGCCCAAAGAGCCCGAAAAGCCCAAAGAAGTTCCTAAACCTAAACCAGAGCCCGAAAAGCCCAAAGAAGTTCCTAAACCTAAA
CCAGAGCXCCGTAATGCCAATGCCAACGCCAGTGCCAATTCAAGAATACCCACAACCGCCACXACGGATATTGTTGTGGACAATGCTACX
GGAGGCCAAACTGGGGGTCCGTGTTATCAAGGGTACGGACGATCGGCCCCTCCGCCACCGGAAACTGTTGTGGACAATGCTAXX\
Edits in Original Sequence 
(5')AAAAGACTACTATCATGGTACTCAAAGTTGATCTTCAATGTTCAAGCTGCTACAAAAAAGTTAAAAAAATTCTCTGXTAAATTCCC
TCAAATTAGAGATCAAGTATATGATGAGAAGGGCAATACAGTCACAATCACTGTTGTTTGTTGTAATCCTGAAAAACTTCGTGACAAATT
GTGTTGTAAAGGATGTGGAGTAATCAAAAGCATTGAAATCAAAGACCCTCCAAAGCCCAAACCTCCCGAAAAGCCCAAAGAGCCCGAAAA
GCCCAAACCTGAAAAGCCTAAAGAGCCCGAAAAACCTAAAGTTGTCGTCATTGAAAAGCCCAAGGAGCCTGAGAAGCCTAAGGTTGTCGT
TACTGAAAAACCTAAAGAACCTGAGAAGCCTAAGATTGTTATCATTAAAGAGCCTCAGAAACCTAAGACACCTGAAAAGCCAAAAGAAGT
TGAGAAGCCTAAGCCCAAAGAGCCCGAAAAGCCCAAAGAAGTTCCTAAACCTAAACCAGAGCCCGAAAAGCCCAAAGAAGTTCCTAAACC
TAAACCAGAGCXCCGTAATGCCAATGCCAACGCCAGTGCCAATTCAAGAATACCCACAACCGCCACXACGGATATTGTTGTGGACAATGC
TACXGGAGGCCAAACTGGGGGTCCGTGTTATCAAGGGTACGGACGATCGGCCCCTCCGCCACCGGAAtACTGTTGTGGACAATGCTAXX\
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan