ESTScan Details for Unigene SGN-U224953

Score 
83
Direction 
Forward
Predicted Peptide Sequence 
EVGSISPQITPKDKATALEMQLWHMCSLENDGKRW
Predicted Coding Sequence 
XXTGAAGTTGGGTCAATTTCACCTCAAATCACACCTAAAGACAAAGCAACAGCTTTGGAGATGCAGCTCTGGCATATGTGCAGTCTGGAA
AATGACGGGAAGCGCTGG\
Edits in Original Sequence 
(5')XXTGAAGTTGGGTCAATTTCACCTCAAATCACACCTAAAGACAAAGCAACAGCTTTGGAGATGCAGCTCTGGCATATGTGCAGTCT
GGAAAATGACGGGAAGCGCTGG\(3')ATTTGTATATTATTAGTGTGACGCTTATGTTATAGATTTGGTTTCTATATTGAGGTTTTTACT
ATTTTTATTTTGATGTTTTCACGAGTGCACGCGCAAAGCGATGGGTGTTCATGCTGTATGCAGTAGCCCTTTTTTACATACCCTTCTTGT
TTAGTGCTATGGATGTTAACAGTCTCCATTTTCTAGATGGTTTAGGTCTTGTTAGTTGAAATCTTTTTGCTTAGGGTTTGAGCTTCTATG
TATAGATCATTGGCACACATGACTAAAGCTTCTAGTTTGAATGTATTGGGTCAGTTGTAATCAGAGGATGAACACGTTTAACGTTTCACA
ATAAGGATGATGCCTTGGTCCCGACTCAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan