ESTScan Details for Unigene SGN-U225061

Score 
194
Direction 
Forward
Predicted Peptide Sequence 
PSLHLCYSYFNFLLQYYLSGGMLVFKTHIPVELTVQGRYLIADDMGQVCDALSIDPHLAAAVGNQSDSLAMVVISFHNVAIPMNFVSLAX
LNPSRTQKDLAVNVKISKPITAGMYSSIFDFCTGRCRHNSESVVHENAYLSEFHHCFSIPSNSSSGGGSGVQTEVRLAGINVVIGRQGES
CDSVCKSSGQSCVPNKFVLLNQCETMHKYLSCKGGCLASVGADX
Predicted Coding Sequence 
XCTCCTTCTTTGCATCTCTGCTATTCATACTTCAATTTTCTTCTCCAGTATTATCTATCAGGAGGGATGTTAGTCTTCAAAACACATATA
CCTGTAGAACTXACCGTTCAAGGAAGATATTTGATTGCCGATGATATGGGTCAAGTCTGTGATGCACTCTCCATTGATCCCCATCTCGCT
GCTGCCGTGGGAAATCAGAGCGATTCTCTTGCAATGGTTGTAATCTCGTTTCACAATGTTGCGATTCCTATGAATTTTGTGTCTCTTGCT
GXTTTGAATCCGTCCAGGACACAAAAGGATCTGGCGGTAAATGTGAAGATATCTAAGCCCATAACAGCAGGGATGTATTCAAGTATTTTT
GATTTTTGTACAGGAAGATGTCGTCATAATTCGGAAAGTGTGGTTCATGAAAACGCTTATCTCAGTGAATTTCATCATTGTTTTTCTATA
CCGTCTAATTCTTCTTCTGGCGGTGGTTCTGGTGTACAAACTGAAGTGAGGTTGGCTGGTATAAATGTTGTGATAGGAAGACAAGGTGAA
TCGTGTGATTCGGTGTGTAAATCTAGTGGTCAGTCTTGTGTTCCGAACAAATTTGTGTTGCTTAATCAGTGTGAAACGATGCATAAGTAC
TTGAGCTGTAAAGGTGGATGTTTGGCAAGTGTTGGAGCTGATCXX\
Edits in Original Sequence 
(5')XCTCCTTCTTTGCATCTCTGCTATTCATACTTCAATTTTCTTCTCCAGTATTATCTATCAGGAGGGATGTTAGTCTTCAAAACACA
TATACCTGTAGAACTXACCGTTCAAGGAAGATATTTGATTGCCGATGATATGGGTCAAGTCTGTGATGCACTCTCCATTGATCCCCATaC
TCGCTGCTGCCGTGGGAAATCAGAGCGATTCTCTTGCAATGGTTGTAATCTCGTTTCACAATGTTGCGATTCCTATGAATTTTGTGTCTC
TTGCTGXTTTGAATCCGTCCAGGACACAAAAGGATCTGGCGGTAAATGTGAAGATATCTAAGCCCATAACAGCAGGGATGTATTCAAGTA
TTTTTGATTTTTGTACAGGAAGATGTCGTCATAATTCGGAAAGTGTGGTTCATGAAAACGCTTATCTCAGTGAATTTCATCATTGTTTTT
CTATACCGTCTAATTCTTCTTCTGGCGGTGGTTCTGGTGTACAAACTGAAGTGAGGTTGGCTGGTATAAATGTTGTGATAGGAAGACAAG
GTGAATCGTGTGATTCGGTGTGTAAATCTAGTGGTCAGTCTTGTGTTCCGAACAAATTTGTGTTGCTTAATCAGTGTGAAACGATGCATA
AGTACTTGAGCTGTAAAGGTGGATGTTTGGCAAGTGTTGGAGCTGATCXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan