ESTScan Details for Unigene SGN-U225085

Score 
376
Direction 
Forward
Predicted Peptide Sequence 
EMQRAMKAVEEMETVGIKPNLKTYTTLIHGWARASLPEKGLKCFEQMKQSGLKPDKAVYHCLMTSLLSRAAVADQDYIITESNMFVKRWW
SXGLTVDMGTAVHWSKCLRKIERTGGDITKSLQKTFPPDWSSHRTLNGTSNDNEIEEGSDSSDDERSSFYEIKKCNNDSDFYEEALANLY
QPLAAAWSQESLGV
Predicted Coding Sequence 
XGAGAAATGCAAAGAGCAATGAAAGCAGTTGAAGAGATGGAAACTGTTGGGATCAAACCTAACTTAAAGACCTATACCACTCTTATACAT
GGTTGGGCACGGGCTTCTCTTCCCGAGAAGGGTTTGAAATGTTTTGAACAGATGAAGCAGTCTGGTTTGAAACCTGACAAAGCTGTATAC
CACTGTTTAATGACATCATTGTTGTCAAGGGCGGCAGTTGCTGATCAAGATTACATTATAACAGAATCCAACATGTTTGTGAAGAGATGG
TGGAGTXCTGGATTGACTGTTGATATGGGAACTGCAGTTCATTGGTCCAAGTGCTTGAGAAAAATTGAGAGGACTGGTGGTGATATAACA
AAATCCCTTCAAAAGACCTTCCCACCTGATTGGAGTTCTCACCGAACTCTTAATGGAACATCAAATGACAACGAGATTGAGGAAGGGTCA
GACAGTAGTGACGATGAACGTAGTTCTTTTTATGAGATAAAGAAATGCAACAATGATTCAGATTTCTACGAAGAGGCATTGGCTAATCTT
TATCAGCCXCTAGCTGCTGCTTGGTCCCAAGAGTCTTTAGGTGTATAG\
Edits in Original Sequence 
(5')XGAGAAATGCAAAGAGCAATGAAAGCAGTTGAAGAGATGGAAACTGTTGGGATCAAACCTAACTTAAAGACCTATACCACTCTTAT
ACATGGTTGGGCACGGGCTTCTCTTCCCGAGAAGGGTTTGAAATGTTTTGAACAGATGAAGCAGTCTGGTTTGAAACCTGACAAAGCTGT
ATACCACTGTTTAATGACATCATTGTTGTCAAGGGCGGCAGTTGCTGATCAAGATTACATTATAACgAGAATCCAACATGTTTGTGAAGA
GATGGTGGAGTXCTGGATTGACTGTTGATATGGGAACTGCAGTTCATTGGTCCAAGTGCTTGAGAAAAATTGAGAGGACTGGTGGTGATA
TAACAAAATCCCTTCAAAAGACCTTCCCACCTGATTGGAGTTCTCACCGAACTCTTAATGGAACATCAAATGACAACGAGATTGAGGAAG
GGTCAGACAGTAGTGACGATGAACGTAGTTCTTTTTATGAGATAAAGAAATGCtAACAATGATTCAGATTTCTACGAAGAGGCATTGGCa
TAATCTTTATCAGCCXCTAGCTGCTGCTTGGTCCCAAGAGTCTTTAGGTGTATAG\(3')ATGGAATTTTGCCACTAGTTTGGCTTGATC
AAGATTGTTTTATTTTTTCGTAAACAACCTCTCTATTTCTACGAGGTAAGGGTAAGGTTTGTGTACACTCTACCCTTCTTGAACCTTGGG
ATTACGTTGGGTATGTGATTATTTGGCTTGATCAAGATTGTGCAATTGATTCCATATTCTTGAATTGTAAATGTCTCTTTTTGGTTTTAG
ACTTGAAGTAGCTAAAGGGATTAGTTTTGGATGTACAAATATGTATTAAATTTGTAACGATTGTCAAATGCACA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan