Notice: The contact form functionality has been restored. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U225125

Score 
210
Direction 
Forward
Predicted Peptide Sequence 
GIVHRDIKPQNIIFSEGSRAFKIIDLGAAADLRVGINYIPKEFLLDPRYAAPEQYIMSTQTPSAPSAPVATALSPVLWQLNLPDRFDIYS
VGLIFLQMAFPGLRSDNSLIQFNRQLKRCDYDLVSWRQSVEPRAGPELRKGFELLDLDGGIGWELLTSMVRFKARQRISAKTALAHPYFD
REGLXSPVLHSEPKAAILAGNTTRL
Predicted Coding Sequence 
XXAGGGATAGTACATAGAGATATTAAGCCTCAAAACATAATTTTCTCTGAAGGTTCTCGCGCGTTCAAAATAATTGATCTTGGTGCTGCA
GCAGATTTGAGAGTAGGAATCAATTATATTCCTAAGGAGTTTCTTTTAGATCCAAGATACGCTGCACCAGAGCAATACATTATGAGCACA
CAAACCCCTTCCGCACCGTCTGCTCCAGTTGCAACTGCACTGTCCCCAGTACTCTGGCAGCTGAATCTCCCAGATCGATTTGACATCTAC
AGTGTCGGTCTCATATTCCTGCAAATGGCATTCCCAGGATTACGCAGTGACAACAGTCTCATTCAATTCAACCGACAACTGAAGAGATGC
GACTATGATTTAGTTTCGTGGAGACAGAGTGTAGAGCCTCGTGCTGGCCCTGAACTTAGGAAAGGCTTCGAGTTGTTAGATTTGGATGGT
GGAATAGGGTGGGAGCTATTAACATCTATGGTACGTTTCAAAGCACGCCAAAGAATTAGTGCAAAGACAGCTTTAGCACATCCATACTTT
GATAGAGAAGGTCTTXCTAGCCCTGTCCTTCATTCAGAACCTAAAGCTGCAATTCTTGCGGGCAACACAACAAGACTA\
Edits in Original Sequence 
(5')XXAGGGATAGTACATAGAGATATTAAGCCTCAAAACATAATTTTCTCTGAAGGTTCTCGCGCGTTCAAAATAATTGATCTTGGTGC
TGCAGCAGATTTGAGAGTAGGAATCAATTATATTCCTAAGGAGTTTCTTTTAGATCCAAGATACGCTGCACCAGAGCAATACATTATGAG
CACACAAACCCCTTCCGCACCGTCTGCTCCAGTTGCAACTGCACTGTCCCCAGTACTCTGGCAGCTGAATCTCCCAGATCGATTTGACAT
CTACAGTGTCGGTCTCATATTCCTGCAAATGGCATTCCCAGGATTACGCAGTGACAACAGTCTCATTCAATTCAACCGACAACTGAAGAG
ATGCGACTATGATTTAGTTTCGTGGAGACAGAGTGTAGAGCCTCGTGCTGGCCCTGAACTTAGGAAAGGCTTCGAGTTGTTAGATTTGGA
TGGTGGAATAGGGTGGGAGCTATTAACATCTATGGTACGTTTCAAAGCACGCCAAAGAATTAGTGCAAAGACAGCTTTAGCACATCCATA
CTTTGATAGAGAAGGTCTTXCTAGCCCTGTCCTTCATTCAGAACCTAAAGCTGCAATTCTTGCGGGCAACACAACAAGACTA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan