ESTScan Details for Unigene SGN-U225240

Score 
126
Direction 
Forward
Predicted Peptide Sequence 
MYQXSRKVFHIRAQLTTEIPAKVAKVSKKQDEGVVVNKFRPKDPYIGRCLLNTKITGDDAPGETWHMVFSTEGMELVCLALTWQEIRPAP
XTVQYVPTEEQPADILTKPLXEPTARLPQFQASVRFRSAQR
Predicted Coding Sequence 
ATGTATCAGXTTAGTAGAAAAGTGTTTCACATTAGAGCCCAACTCACAACGGAAATACCTGCAAAGGTTGCGAAGGTATCGAAGAAACAG
GATGAAGGTGTAGTTGTAAACAAGTTCAGGCCAAAGGATCCTTATATTGGCAGATGCCTTCTCAACACTAAGATCACTGGAGATGATGCC
CCTGGAGAAACTTGGCACATGGTCTTTTCCACTGAGGGTATGGAACTTGTTTGTCTGGCTTTGACTTGGCAAGAAATTAGGCCGGCACCA
XTGACTGTGCAGTATGTACCCACTGAAGAACAACCGGCTGATATTCTCACCAAGCCTCTCXCCGAGCCGACTGCACGATTACCTCAGTTC
CAAGCTTCCGTTCGCTTCCGCTCAGCTCAGCGATAA\
Edits in Original Sequence 
CATTAAGTGCTTCAGTCTCTCTACAATCCTCTAATTCAACTTCTCTTTCAATCAAAACCATCTTCATTTCCCCTGAAAATATCACTTTCA
ACAAGGTAAATTTCATTTTCTTTTCCTTTTTTCTCGGTGATGATCGTCACACGAATATAAAAGAATTTTCACTTAAGATGTTGTAAAAGA
TTACTAAGCAGTTCACTTACTACAATTTTATTTACTTTTCTAGTGACTTATACTTCATAGTGTAAAATAATAATTCAAAAAGCTACACTC
TGAGTGTACACAAGCTATATTTGTTTGAACAGGTTCTTTTATGCAACAAGAA
(5')ATGTATCAGXTTAGTAGAAAAGTGTTTCACATTA
GAGCCCAACTCACAACGGAAATACCTGCAAAGGTTGCGAAGGTATCGAAGAAACAGGATGAAGGTGTAGTTGTAAACAAGTTCAGGCCAA
AGGATCCTTATATTGGCAGATGCCTTCTCAACACTAAGATCACTGGAGATGATGCCCCTGGAGAAACTTGGCACATGGTCTTTTCCACTG
AGGGTATGGAACTTGTTTGTCTGGCTTTGACTTGGCAtAGAAATTAGGCCGGCACCAXTGACTGTGCAGTATGTACCCACTGAAGAACAA
CCGGCTGATATTCTCACCAAGCCTCTCXCCGAGCCGACTGCACGATTACCTCAGTTCCAAGCTTCCGTTCGCTTCCGCTCAGCTCAGCGA
TAA\(3')TAACATATAGTATTAAATAATATTAGTATTTACTATGTACTAATCCTAGTCCTATTAGGATTAGTACTCCTTAATCCTAGTC
CTATTAGGATTAGTACTCCTTCCTATCTCCTATATATATCTCCCATGTATTCCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan