ESTScan Details for Unigene SGN-U225257

Score 
677
Direction 
Forward
Predicted Peptide Sequence 
DNEDDEEEEENGYKGFRDLIDSEEESEESDEDNEVEDEKMASLEEDSPRASSPSSHGKSDSHLTETRFDQFPLSPLSLKGVKDAGYKTMT
VVQEATLPIILKVPVESIVFGRQGRSGQGKDGTGKTVAFLLPSIEVVVKSPPNTRDQKRPPILVLVICPTRELATQAAAEANTLLKYHPS
IGVQVVIGGTRLALEQKRMQANPCQILVATPGRLRDHVENTAGFATRLMGVKVLVLDEADHLLDMGFRKEIERIISAIPKQRQTLLFSAT
V
Predicted Coding Sequence 
GATAATGAGGATGATGAAGAGGAAGAGGAGAATGGTTATAAGGGGTTCCGAGATTTGATTGACAGCGAGGAAGAAAGTGAAGAATCTGAT
GAAGACAATGAGGTCGAGGATGAAAAGATGGCCTCATTGGAGGAGGACAGTCCAAGGGCATCAAGCCCGAGCTCACATGGAAAAAGTGAT
TCCCACCTCACCGAAACCAGGTTTGATCAGTTTCCTCTCTCTCCCTTGTCTCTGAAAGGAGTTAAAGATGCTGGATACAAAACGATGACT
GTAGTGCAGGAGGCAACCCTTCCCATTATTCTAAAAGTGCCTGTTGAATCCATTGTATTTGGTAGGCAAGGACGTTCTGGCCAAGGCAAA
GATGGCACTGGGAAAACTGTAGCATTTTTGCTTCCTTCAATTGAAGTTGTTGTAAAATCACCCCCCAACACCCGTGATCAAAAGAGGCCA
CCAATTCTGGTGCTTGTGATATGCCCTACCCGGGAGCTTGCAACTCAAGCAGCTGCCGAGGCCAACACCTTGTTAAAATATCACCCTTCA
ATTGGGGTTCAAGTTGTTATAGGCGGAACAAGGCTTGCACTTGAGCAGAAAAGGATGCAAGCAAATCCATGTCAGATACTTGTGGCGACA
CCTGGGAGACTCAGAGATCATGTAGAGAATACAGCAGGATTTGCTACTCGGTTGATGGGTGTTAAAGTGTTGGTCCTTGATGAAGCCGAT
CATTTGTTGGATATGGGATTCCGTAAAGAAATTGAGAGAATCATCTCTGCTATTCCAAAACAGCGCCAAACACTTCTCTTTTCTGCAACA
GTX\
Edits in Original Sequence 
GAATTCGGCACGAGGC(5')GATAATGAGGATGATGAAGAGGAAGAGGAGAATGGTTATAAGGGGTTCCGAGATTTGATTGACAGCGAGG
AAGAAAGTGAAGAATCTGATGAAGACAATGAGGTCGAGGATGAAAAGATGGCCTCATTGGAGGAGGACAGTCCAAGGGCATCAAGCCCGA
GCTCACATGGAAAAAGTGATTCCCACCTCACCGAAACCAGGTTTGATCAGTTTCCTCTCTCTCCCTTGTCTCTGAAAGGAGTTAAAGATG
CTGGATACAAAACGATGACTGTAGTGCAGGAGGCAACCCTTCCCATTATTCTAAAAGTGCCTGTTGtAATCCATTGTATTTGGTAGGCAA
GGACGTTCTGGCCAAGGCAAAGAcTGGCACTGGGAAAACTGTAGCATTTTTGCTTCCTTCAATTGAAGTTGTTGTAAAATCACCCCCCAA
CACCCGTGATCAAAAGAGGCCACCAATTCTGGTGCTTGTGATATGCCCTACCCGGGAGCTTGCAACTCAAGCAGCTGCCGAGGCCAACAC
CTTGTTAAAATATCACCCTTCAATTGGGGTTCAAGTTGTTATAGGCGGAACAAGGCTTGCACTTGAGCAGAAAAGGATGCAAGCAAATCC
ATGTCAGATACTTGTGGCGACACCTGGGAGACTCAGAGATCATGTAGAGAATACAGCAGGATTTGCTACTCGGTTGATGGGTGTTAAAGT
GTTGGTCCTTGATGAAGCCGATCATTTGTTGGATATGGGATTCCGTAAAGAAATTGAGAGAATCATCTCTGCTATTCCAAAACAGCGCCA
AACACTTCTCTTTTCTGCAACAGTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan