ESTScan Details for Unigene SGN-U225299

Score 
213
Direction 
Forward
Predicted Peptide Sequence 
MSSSKIIDISLYRGKINFYRGSNIVIVISLFELPVCIPELSESCTVLSMKNPGSLASANKLSLPAFEPQKTCLVYLQDIVEHIIVPLELT
LKLEKYGKIQLSSHQLVPRIYLPCKASMPV
Predicted Coding Sequence 
ATGTCGTCATCAAAAATAATTGATATTTCACTTTATCGTGGAAAGATCAATTTCTATCGAGGATCTAACATTGTCATTGTCATTTCATTA
TTTGAACTTCCTGTTTGCATTCCTGAGTTATCTGAATCATGTACTGTTCTTTCCATGAAAAATCCTGGTTCTTTAGCTTCTGCCAATAAA
CTCTCATTACCTGCATTTGAACCACAGAAGACATGTTTGGTCTATCTTCAGGACATTGTTGAACACATAATAGTCCCACTTGAATTGACC
TTAAAACTTGAGAAATATGGCAAGATTCAGCTATCTTCTCATCAATTAGTTCCAAGGATCTATCTTCCTTGTAAAGCTTCCATGCCTGTT
TAA\
Edits in Original Sequence 
TTTTTTTTTTGATTTGATTTGATTTTATATATTATGATAGGCTATATAATTTTGCTTACTAGAATTTACATTTCTTTCTAAGATAAGATA
CAAATGAAAATCCAGTTGTATATCTCACAACAAATGCAAAAAAAGAGTCAAGATCGCATAACTGCTTATAATAGCATGTCAATTATGATT
TATGAACCATTTTTCTAAATACTCAAAAGGCACGCTTAATAGTCCCTGAGGTGATGCTCGAGCGCTTCA
(5')ATGTCGTCATCaAAAAA
TAATTGATATTTCACTTTATCGTGGAAAGATCAATTTCTATCGAGGATCTAACATTGTCATTGTCATTTCATTATTTGAACTTCCTGTTT
GCATTCCTGAGTTATCTGAATCATGTACTGTTCTTTCCATGAAAAATCCTGGTTCTTTAGCTTCTGCCAATAAACTCTCATTACCTaGCA
TTTGAACCACAGAAGACATGTTTGGTCTATCTTCAGGACATTGTTGAACACATAATAGTCCCACTTGAATTGACCTTAAAACTTGAGAAA
TATGGCAAGATTCAGCTATCTTCTCATCAATTAGTTCCAAGGATCTATCTTCCTTGTAAAGCTTCCATGCCTGTTTAA\(3')GTAATTT
AACATCATGACAAATATTCTATAGGTAATATAGACAATGTATAGATAGAGTGCTTACGTGACCGAGAAGGTTAAGGTTGTGATTTTGATG
GACGAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan