ESTScan Details for Unigene SGN-U225346

Score 
220
Direction 
Forward
Predicted Peptide Sequence 
MASSDNLMTMEPWAFRSAFADSWFSDVYTRETETLTKVLQKSAFPEPEMNPVQTSTGTNSGGSENETTGVSNRRSNKVRVNGKITKRKSR
ALRRNTTTYITADVDNFREMX
Predicted Coding Sequence 
ATGGCTTCTTCTGACAATTTAATGACCATGGAGCCATGGGCTTTCCGTTCTGCTTTTGCTGATTCTTGGTTTTCTGACGTATACACCAGA
GAAACTGAAACATTAACCAAAGTCCTCCAAAAATCTGCCTTCCCGGAACCGGAGATGAACCCGGTTCAAACTTCGACCGGAACCAATTCC
GGTGGGTCGGAGAATGAGACGACCGGTGTTTCGAATCGGAGGAGCAATAAAGTCCGAGTGAACGGGAAGATAACTAAGAGGAAGTCACGT
GCTTTAAGGCGTAATACGACGACGTATATAACTGCTGACGTGGATAATTTCCGTGAAATGGXX\
Edits in Original Sequence 
GCAATCCAACACATTTTATTTCTCTAAAAATTGAATCTTTTTAGCTTTAAATCTCCAATTCCTGTACGAAAA(5')ATGGCTTCTTCTGA
CAATTTAATGACCATGGAGCCATGGGCTTTCCGTTCTGCTTTTGCTGATTCTTGGTTTTCTGACGTATACACCAGAGAAACTGAAACATT
AACCAAAGTCCTCCAAAAATCTGCCTTCCCGGAACCGGAGATGAACCCGGTTCAAACTTCGACCGGAACCAATTCCGGTGGGTCGGAGAA
TGAGACGACCGGTGTTTCGAATCGGAGGAGCAATAAAGTCCGAGTGAACGGGAAGATAACTAAGAGGAAGTCACGTGCTTTAAGGCGTAA
TACGACGACGTATATAACTGCTGACGTGGATAATTTCCGTGAAATGGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan