ESTScan Details for Unigene SGN-U225371

Score 
553
Direction 
Forward
Predicted Peptide Sequence 
ATEFPHTILSCAVSSKVEISYRKMKVHSCIHPLPSTPSTGILVSAGPAEAKLAANTRKLYSLTLNSSNYVPFPYKDQKFSRSSSTDFSRT
AIGSNVSEDTDDMFDDLLRTHGKVVYKRNDQKPASEEIDDDAESLSFAMAVAKVASDVKAGDIKVLFVKPLVYWTRFFIIATAFSRPQID
AIGTRVRDMAEEQYGRVASGDSNPTRGHYWTLVXVVVHLFLPPQREYYNLXEFYGNAASIELPFX
Predicted Coding Sequence 
GCAACTGAGTTTCCCCATACAATCCTCTCTTGTGCAGTATCTTCTAAAGTTGAAATCTCGTATAGAAAAATGAAAGTACACTCCTGCATT
CATCCTCTTCCCTCTACTCCCTCCACCGGAATTTTGGTCTCTGCCGGTCCTGCGGAAGCTAAGCTTGCTGCTAACACCAGAAAGCTTTAT
TCTTTAACTTTGAATTCCTCTAATTATGTCCCATTTCCTTATAAAGATCAGAAATTTTCCAGAAGCAGCTCTACGGATTTTTCTAGAACG
GCTATCGGTTCGAATGTAAGTGAAGATACAGATGACATGTTTGATGATCTCCTAAGAACGCATGGCAAAGTGGTATACAAAAGAAATGAC
CAAAAACCTGCAAGTGAGGAGATTGATGATGATGCTGAAAGCCTATCGTTTGCAATGGCTGTGGCTAAAGTTGCAAGTGATGTCAAGGCT
GGAGATATAAAGGTCCTCTTTGTCAAGCCTCTAGTATATTGGACTCGGTTTTTCATTATTGCTACTGCATTCTCTCGCCCACAGATTGAT
GCCATTGGGACCAGAGTAAGAGATATGGCTGAGGAACAATATGGAAGAGTTGCTTCTGGAGATTCAAACCCAACTCGTGGACACTACTGG
ACTTTGGTGATNGTCGTTGTTCATCTATTTCTTCCTCCGCAGCGTGAGTACTACAACCTGNAAGAATTCTATGGCAATGCAGCATCCATC
GAACTACCATTTGXX\
Edits in Original Sequence 
(5')GCAACTGAGTTTCCCCATACAATCCTCTCTTGTGCAGTATCTTCTAAAGTTGAAATCTCGTATAGAAAAATGAAAGTACACTCCTG
CATTCATCCTCTTCCCTCTACTCCCTCCACCGGAATTTTGGTCTCTGCCGGTCCTGCGGAAGCTAAGCTTGCTGCTAACACCAGAAAGCT
TTATTCTTTAACTTTGAATTCCTCTAATTATGTCCCATTTCCTTATAAAGATCAGAAATTTTCCAGAAGCAGCTCTACGGATTTTTCTAG
AACGGCTATCGGTTCGAATGTAAGTGAAGATACAGATGACATGTTTGATGATCTCCTAAGAACGCATGGCAAAGTGGTATACAAAAGAAA
TGACCAAAAACCTGCAAGTGAGGAGATTGATGATGATGCTGAAAGCCTATCGTTTGCAATGGCTGTGGCTAAAGTTGCAAGTGATGTCAA
GGCTGGAGATATAAAGGTCCTCTTTGTCAAGCCTCTAGTATATTGGACTCGGTTTTTCATTATTGCTACTGCATTCTCTCGCCCACAGAT
TGATGCCATTGGGACCAGAGTAAGAGATATGGCTGAGGAACAATATGGAAGAGTTGCTTCTGGAGATTCaAAACCCAACTCGTGGACACT
ACTGGACTTTGGTGATNGTCGTTGTTCATCTATTTCTTCCTCCGCAGCGTGAGTACTACAACCTGNAAGAATTCTATGGCAATGCAGCAT
CCATCGAACTACCATTTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan