ESTScan Details for Unigene SGN-U225466

Score 
501
Direction 
Forward
Predicted Peptide Sequence 
KYHLCLDLVKQVPLFQHMDSLVLENICDRVKSLIFTKGETVSGVFACNNIKETINATKYEKHRMVDEKKKVPRELKQRTRNFQRQKWAAM
RGVDECDMIRNIPEGLRRDIKYHLCLDLVKQVPLFQHMDSLVLENICDRVKSLIFTKGETVSREGDPVQRMLFIVRGHLQSSQYLRDGVK
SYCMLGPGNFSGDELLSWCLRRPFVERLPPSSSTLVTLETTEAFGLEAEDVKYVTQHFRYTFVDEKVKRSARYYSPGWRTWGAVAXSISL
EKI
Predicted Coding Sequence 
XXCAAGTATCATTTGTGCTTAGACTTGGTCAAACAGGTCCCTTTGTTTCAACATATGGACAGTTTGGTTCTAGAGAACATATGTGATCGT
GTCAAGTCATTGATTTTCACTAAGGGGGAAACAGTATCTGGTGTTTTTGCATGCAACAACATCAAAGAAACAATCAATGCAACTAAATAT
GAGAAACATAGAATGGTGGATGAGAAGAAGAAGGTTCCTAGAGAGTTAAAGCAAAGAACTAGAAATTTTCAAAGGCAAAAATGGGCTGCA
ATGCGTGGTGTTGATGAATGTGACATGATTAGAAATATTCCTGAGGGTCTAAGGAGGGACATCAAGTATCATTTGTGCTTAGACTTGGTC
AAACAGGTCCCTTTGTTTCAACATATGGACAGTTTGGTTCTAGAGAACATATGTGATCGTGTCAAGTCATTGATTTTCACTAAGGGGGAA
ACAGTATCTAGAGAGGGTGATCCAGTACAAAGAATGTTATTTATTGTAAGAGGACACCTTCAAAGTAGCCAATATTTACGAGATGGTGTC
AAAAGTTATTGCATGTTAGGCCCTGGAAATTTTAGTGGAGATGAACTTTTGTCCTGGTGTCTCCGGCGACCTTTCGTCGAGCGGTTGCCA
CCGTCCTCCTCCACGTTGGTGACCCTCGAGACCACCGAGGCCTTCGGCCTCGAGGCCGAAGACGTCAAGTATGTGACACAACATTTCAGA
TATACATTTGTGGATGAGAAAGTGAAGAGAAGTGCAAGGTATTATTCACCAGGGTGGAGAACTTGGGGTGCTGTTGCTXATTCAATTAGC
TTGGAGAAGATATAA\
Edits in Original Sequence 
(5')XXCAAGTATCATTTGTGCTTAGACTTGGTCAAACAGGTCCCTTTGTTTCAACATATGGACAGTTTGGTTCTAGAGAACATATGTGA
TCGTGTCAAGTCATTGATTTTCACTAAGGGGGAAACAGTATCTaGGTGTTTTTGCATGCAACAACATCAAAGAAACAATCAATGCAACTA
AATATGAGAAACATAGAATGGTGGATGAGAAGAAGAAGGTTcCCTAGAGAGTTAAAGCAAAGAACTAGAAATTTTCAAAGGCAAAAATGG
GCTGCAATGCGTGGTGTTGATGAATGTGACATGATTAGAAATATTCCTGAGGGTCTAAGGAGGGACATCAAGTATCATTTGTGCTTAGAC
TTGGTCAAACAGGTCCCTTTGTTTCAACATATGGACAGTTTGGTTCTAGAGAACATATGTGATCGTGTCAAGTCATTGATTTTCACTAAG
GGGGAAACAGTATCTAGAGAGGGTGATCCAGTACAAAGAATGTTATTTATTGTAAGAGGACACCTTCAAAGTAGCCAATATTTACGAGAT
GGTGTCAAAAGTTATTGCATGTTAGGCCCTGGAAATTTTAGTGGAGATGAACTTTTGTCCTGGTGTCTCCGGCGACCTTTCGTCGAGCGG
TTGCCACCGTCCTCCTCCACGTTGGTGACCCTCGAGACCACCGAGGCCTTCGGCCTCGAGGCCGAAGACGTCAAGTATGTGACACAACAT
TTCAGATATACATTTGTGGATGAGAAAGTGAAGAGAAGTGCAAGGTATTATTCACCAGGGTGGAGAACTTGGGGTGCTGTTGCTXATTCA
ATTAGCTTGGAGAAGATATAA\(3')ACATCGTTTGACACTTTCTTCTTTGTCTTTTATTAGACCAAGAAGGCCATTGTCTCGTTGTTCG
TCGCTCGGGGAGAATCGTCTAAGACTATATACTGCGTTGTTGACTTCACCAAAACCTAACCTAGATGATTTTGATTTTTAATTTTTTTTT
TTAAAAAATAAATAATATAATAATAAGTCATATGTACTTATGTATATTTATAATTAGGTTGTGATTAACACTTAATGAGATACTACACAT
GATGGTCTCATGATATACATGAATTTGGTTATTTTTTGTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan