ESTScan Details for Unigene SGN-U225545

Score 
90
Direction 
Forward
Predicted Peptide Sequence 
MASSIVSSAAAATRSNVAQASMVAPFTGLKSAASFPVTKKNNNVDITSLASNGGRLDAAGYSKISDSIISMYNNLNSTRLFYNRGMFDNV
GVPPINMKKYETLSYLPDLSDEQLLSEIEYLLKNGWVPCLEFETEVKSRILFNDLSNYLKYKNNLNCRLFVIYVCNSADLCTERTTXSPG
YYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEGF
Predicted Coding Sequence 
ATGGCTTCCTCAATTGTCTCATCGGCAGCCGCTGCTACCCGTAGCAATGTTGCTCAAGCTAGCATGGTCGCACCCTTCACCGGACTCAAA
TCCGCCGCTTCTTTTCCCGTTACCAAGAAGAACAACAACGTTGACATTACCTCCCTTGCTAGCAATGGTGGACGGTTAGATGCTGCAGGT
TATTCAAAAATAAGTGATTCAATTATCAGTATGTATAATAATTTAAATTCAACGCGATTATTTTATAATCGTGGAATGTTTGACAATGTA
GGTGTGCCACCAATCAACATGAAGAAATACGAGACATTGTCATACCTTCCTGACTTGTCCGATGAGCAATTGCTTAGCGAAATTGAGTAT
CTTTTGAAAAATGGATGGGTTCCTTGCTTGGAATTCGAGACTGAGGTCAAATCTCGTATTTTATTTAATGATTTATCTAATTATTTGAAG
TATAAAAATAATTTGAACTGTCGTTTGTTTGTAATATATGTATGTAACAGCGCGGATTTGTGTACCGAGAGAACAACAGXTTCCCCTGGA
TACTACGATGGTAGATACTGGACCATGTGGAAGTTACCTATGTTTGGGTGCACTGATGCAACACAGGTGTTGGCTGAGGTTCAAGAGGCG
AAGAAGGCGTACCCACAAGCCTGGGTTCGTATTATCGGATTCGACAACGTTCGTCAAGTCCAGTGCATCAGCTTCATTGCCTACAAGCCA
GAAGGATTCTAA\
Edits in Original Sequence 
TTAAAAAAAAAAAAAACATTTTATAGCTAAGTAAGTAAACGCA(5')ATGGCTTCCTCAATTGTCTCATCGGCAGCCGCTGCTACCCGTA
GCAATGTTGCTCAAGCTAGCATGGTCGCACCCTTCACCGGACTCAAATCCGCCGCTTCTTTTCCCGTTACCAAGAAGAACAACAACGTTG
ACATTACCTCCCTTGCTAGCAATGGTGGACGcGTTAGATGCaTGCAGGTTATTCAAAAATAAGTGATTCAATTATCAGTATGTATAtATA
ATTTAAATTCAACGCGATTATTTTATAATCGTGGAATGTTTGACtAATGTAGGTGTgGCCACCAATCAACATGAAGAAATACGAGACATT
GTCATACCTTCCTGACTTGTCCGATGAGCAATTGCTTAGCGAAATTGAGTATCTTTTGAAAAATGGATGGGTTCCTTGCTTGGAATTCGA
GACTGAGGTCAAtATCTCGTATTTTATTTAATGATTTATCTAATTATTTGAAGtTATAAAAATAATTTGAACTGTCGTTTGTTTGTAATA
TATGTATGTAACAGCGCGGATTTGTGTACCGAGAGAACAACAGXTTCCCCTGGATACTACGATGGTAGATACTGGACCATGTGGAAGTTA
CCTATGTTTGGGTGCACTGATGCAACACAGGTGTTGGCTGAGGTTCAAGAGGCGAAGAAGGCGTACCCACAAGCCTGGGTTCGTATTATC
GGATTCGACAACGTTCGTCAAGTCCAGTGCATCAGCTTCATTGCCTACAAGCCAGAAGGATTCTAA\(3')ATTTCCAAACATATAATCA
AAATGTTTGTTTGATTTGTACCTAAGTCTTTAATTTTTTTTCTTCAATTTTTGTTTTGCATTTTGTTCCTATTTGTACCGGTGTATTTTC
TTCGATTCCGACCAAGTTATGAGAAATTAATAATGATGAATCGGTGGTTATATGTTTAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan