ESTScan Details for Unigene SGN-U225576

Score 
445
Direction 
Forward
Predicted Peptide Sequence 
MAEGRGSSLVHLLVIILSLVAFGFAIAAERRRSTGTLHDDTITNRTYCVYTSDVATGYGVGAFLFLLSGEALLMGVTKCMCFGRPLSPGS
NRAWTIIYFVSSWLTFLVAEACVIAGAKQNAYHTKYRDMLLAENFSCETLRKGVFVAGAVFIVATMILNVYFYMYFTKATTQPAHKTIVL
AQYRDGWLCIDFAEEL
Predicted Coding Sequence 
ATGGCGGAAGGCAGAGGATCTTCCCTTGTTCATCTACTCGTGATTATACTGAGCTTAGTCGCTTTCGGATTCGCCATTGCCGCCGAACGT
CGCCGGAGCACTGGTACTCTGCATGATGATACTATTACCAATCGTACATATTGTGTTTACACCTCAGACGTTGCTACTGGATATGGAGTA
GGTGCTTTCTTGTTTCTTCTTTCAGGTGAGGCATTGCTTATGGGAGTGACAAAATGCATGTGCTTCGGAAGACCTTTATCTCCTGGTTCA
AATCGTGCATGGACCATTATATACTTCGTATCATCATGGTTGACATTCCTGGTTGCTGAGGCATGTGTTATTGCTGGAGCAAAGCAAAAT
GCGTACCACACCAAGTATCGTGATATGCTCTTAGCAGAAAACTTCTCTTGCGAAACGCTAAGGAAAGGTGTCTTTGTTGCTGGAGCAGTC
TTTATCGTTGCAACCATGATCCTTAATGTGTATTTCTACATGTATTTCACGAAGGCTACTACTCAGCCAGCTCACAAGACAATCGTACTA
GCTCAATATCGGGATGGCTGGTTATGCATAGATTTTGCAGAAGAACTTTAG\
Edits in Original Sequence 
ACAAAACACACTCACTAAGAACACACAGTTCACACACACTCTTGAACTGAAGTGAAAAGCCCTAAATCGAAGCTTTGAGAA(5')ATGGC
GGAAGGCAGAGGATCTTCCCTTGTTCATCTACTCGTGATTATACTGAGCTTAGTCGCTTTCGGATTCGCCATTGCCGCCGAACGTCGCCG
GAGCACTGGTACTCTGCATGATGATACTATTACCAATCGTACATATTGTGTTTACACCTCAGACGTTGCTACTGGATATGGAGTAGGTGC
TTTCTTGTTTCTTCTTTCAGGTGAGGCATTGCTTATGGGAGTGACAAAATGCATGTGCTTCGGAAGACCTTTATCTCCTGGTTCAAATCG
TGCATGGACCATTATATACTTCGTATCATCATGGTTGACATTCCTGGTTGCTGAGGCATGTGTTATTGCTGGAGCAAAGCAAAATGCGTA
CCACACCAAGTATCGTGATATGCTCTTAGCAGAAAACTTCTCTTGCGAAACGCTAAGGAAAGGTGTCTTTGTTGCTGGAGCAGTCTTTAT
CGTTGCAACCATGATCCTTAATGTGTATTTCTACATGTATTTCACGAAGGCTACTACTCAGCCAGCTCACAAGACAATCGTACTAGCTCA
ATATCGGGATGGCTGGTTATGCATAGATTTTGCAGAAGAACTTTAG\(3')CCTAGGCTCTATATTACCTACATCATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan