ESTScan Details for Unigene SGN-U225607

Score 
532
Direction 
Forward
Predicted Peptide Sequence 
TPLHLAAKGGHVRVMDELLERGADIDARAKGACAWTPLHHAAKEKKKKAIKFLIRNGAFLPDDISDTRFNPPLHYCPGLEWAYEEMKLLQ
LESSSSGEASYSSEN
Predicted Coding Sequence 
ACCCCACTTCATCTTGCTGCTAAGGGAGGTCACGTGAGAGTTATGGATGAATTACTTGAGAGGGGTGCTGATATCGATGCTCGAGCCAAG
GGTGCATGTGCATGGACTCCTCTCCATCATGCTGCGAAAGAGAAAAAGAAGAAAGCGATTAAATTCTTGATTAGAAATGGTGCATTTTTG
CCAGATGACATCTCTGACACCAGGTTCAATCCACCACTTCACTATTGTCCTGGTCTTGAATGGGCATATGAGGAGATGAAGCTGCTTCAG
CTAGAGAGTTCATCATCTGGCGAGGCCTCCTACAGCTCGGAAAACTGA\
Edits in Original Sequence 
(5')ACCCCACTTCATCTTGCTGCTAAGGGAGGTCACGTGAGAGTTATGGATGAATTACTTGAGAGGGGTGCTGATATCGATGCTCGAGC
CAAGGGTGCATGTGCATGGACTCCTCTCCATCATGCTGCGAAAGAGAAAAAGAAGAAAGCGATTAAATTCTTGATTAGAAATGGTGCATT
TTTGCCAGATGACATCTCTGACACCAGGTTCAATCCACCACTTCACTATTGTCCTGGTCTTGAATGGGCATATGAGGAGATGAAGCTGCT
TCAGCTAGAGAGTTCATCATCTGGCGAGGCCTCCTACAGCTCGGAAAACTGA\(3')GGCAGAATCGAATGTGTTCCAAGTGTTGTTGGT
GTGTAGAGTTCAGGATGGACTCCTCTCAATGTTATCTACTGCATATTAAGTAGTGTCGTCAGTCTACTCAAGTGTTGCGTTTGGATTTGA
TATATTCTCTATCTTTGTGATTTGCGTGTTTGGTATTTTACCAAGTAGTTGTTACTGTGACTCGATCACTGTAAACAATCTCTCTCTCTC
TGTTCACCATTTGCTATAACTGTGTGACATGTCGTCGAAAAAACATTTCATATGTGAAAAGAAAACAATATGATTGTGGGTTTTGCGAGT
TCTAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan