ESTScan Details for Unigene SGN-U225642

Score 
146
Direction 
Reverse
Predicted Peptide Sequence 
CLIRKEIVFERPGISGTSILPDGKIAATAGWDQRVRIYNYRKGKPLAILKYHNTTCNAVSFSADNNYWPASEDTTVALWELYPPEHDIVS
VVDPRGLFVMNGLTSVVLQRESDPPDEHMELLEDITDH
Predicted Coding Sequence 
TGTTTGATAAGAAAAGAAATTGTTTTTGAGCGACCTGGCATCTCTGGAACCTCAATCCTCCCAGATGGAAAAATCGCTGCAACTGCTGGT
TGGGATCAACGGGTTAGGATTTACAATTATCGCAAAGGAAAGCCTCTGGCTATTTTGAAATATCATAACACCACGTGCAACGCTGTTTCA
TTCTCTGCTGATAACAATTATTGGCCTGCATCTGAAGATACAACAGTGGCTCTCTGGGAACTTTATCCCCCTGAACATGACATTGTATCX
GTTGTTGATCCTCGTGGATTGTTTGTAATGAATGGGTTAACGTCTGTAGTTTTGCAGCGCGAGAGTGATCCXCCAGATGAGCATATGGAG
TTGCTGGAAGATATTACTGATCATTAG\
Edits in Original Sequence 
(5')TGTTTGATAAGAAAAGAAATTGTTTTTGAGCGACCTGGCATCTCTGGAACCTCAATCCgTCCCAGATGGAAAAATCGCTGCAACTG
CTGGTTGGGATCAACGGGTTAGGATTTACAATTATCGCAAAGGAAAGCCTCTGGCTATTTTGAAATATCATAACACCACGTGCAACGCTG
TTTCATTCTCTGCTGATAACaAATTATTGGCCTGCATCTGAAGATACAACAGTGGCTCTCTGGGAACTTTATCCCCCTaGAACATGACAT
TGTATCXGTTGTTGATCCTCGTGGATTGTTTGTAATGAATGGGTTAACGTCTGTAGTTTTGCAGCGCGAGAGTGATCCXCCAGATGAGCA
TATGGAGTTGCTGGAAGATATTACTGATCATTAG\(3')AAAGAGAAGAGGACCTTAGGCTATTTTTGGCAAATGGACACTTTGGTCCGG
CCTTTCCCCCGACCCTGCATATAGCGAAAGCTTAGTATATTGAACTATATTGCTTTTCAAGTTGTTTGAAAGAAACATAGTTGTGAAAAT
ACTAAAAAAGAACTCTACTTGTAACTCTTAAACAAGAAGAGTTGTATATCAAGCTCTTCCTTTACTATCAAGGTTTTGTTAAGTTTAATA
TTTAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan