ESTScan Details for Unigene SGN-U225675

Score 
129
Direction 
Forward
Predicted Peptide Sequence 
DFEELCQRNLAANTGMNFYDFFIFIVRFAFANVVLLHTLAHVKNETSRKPSKALQHIYFNLESIRNVAVKMKPINTGDRQGVLLDLRKNL
EDHSFIELCAAVRKTYELIHDQDETTPTLLQCTSSVRSQVQSSEDLVAFINDALTKRGGAFSC
Predicted Coding Sequence 
GACTTTGAGGAGCTTTGCCAACGAAATCTTGCCGCTAATACAGGAATGAATTTCTATGACTTCTTCATCTTCATTGTGCGCTTTGCATTT
GCAAACGTAGTCCTACTACATACACTTGCCCATGTAAAGAATGAAACAAGTCGGAAACCATCAAAAGCACTGCAGCATATATATTTTAAC
CTCGAATCAATAAGAAACGTCGCTGTGAAAATGAAGCCCATAAATACAGGGGACAGGCAAGGTGTTTTACTTGACTTGAGGAAAAACTTG
GAGGATCACTCGTTTATAGAGCTCTGTGCAGCTGTTAGAAAAACATATGAACTGATACATGACCAAGATGAGACGACCCCTACATTATTG
CAGTGTACTAGTTCTGTTAGATCTCAAGTTCAGAGTTCTGAAGACCTCGTTGCCTTTATCAATGATGCTTTGACTAAACGAGGTGGTGCT
TTTTCTTGTTAG\
Edits in Original Sequence 
(5')GACTTTGAGGAGCTTTGCCAACGAAATCTTGCCGCTAATACAGGAATGAATTTCTATGACTTCTTCATCTTCATTGTGCGCTTTGC
ATTTGCAAACGTAGTCCTACTACATACACTTGCCCATGTAAAGAATGAAACAAGTCGGAAACCATCAAAAGCACTGCAGCATATATATTT
TAACCTCGAATCAATAAGAAACGTCGCTGTGAAAATGAAGCCCATAAATACAGGGGACAGGCAAGGTGTTTTACTTGACTTGAGGAAAAA
CTTGGAGGATCACTCGTTTATAGAGCTCTGTGCAGCTGTTAGAAAAACATATGAACTGATACATGACCAAGATGAGACGACCCCTACATT
ATTGCAGTGTACTAGTTCTGTTAGATCTCAAGTTCAGAGTTCTGAAGACCTCGTTGCCTTTATCAATGATGCTTTGACTAAACGAGGTGG
TGCTTTTTCTTGTTAG\(3')GAATATCTGTACACATATATGAAGCAAGAAGTTCATGTTCTTTGCATATCGATAGAGGACATCACGCCT
GATTCTCAAGGAAAAATTGAATGTTTTTAGGATGATTCTACTACTATTTTTTTCTTAAATGCTTTGAACATGTTGGAGAAGTAAATATTC
CTGCATTTTACTTGTATTAGTCATGGTCTGAACTTTGAAAATGTACGTCTACAACTTTTGGACAGTTTATTTGAATTAGGCTTGCCTACC
TATTGACGGGAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan