ESTScan Details for Unigene SGN-U225810

Score 
104
Direction 
Reverse
Predicted Peptide Sequence 
MKNEKINNPDKLANNSPSNVQFVITINIIGXADTTDTPPAHTMACHSTSPYPLVLVFQSHMHIQPLLX
Predicted Coding Sequence 
ATGAAGAATGAAAAGATAAATAACCCAGACAAGTTGGCCAATAATAGCCCCTCTAATGTACAGTTTGTTATAACAATAAACATAATTGGT
XCTGCAGATACTACCGATACTCCACCAGCACATACAATGGCTTGCCATTCAACTTCTCCTTACCCTTTAGTTCTGGTATTTCAATCACAC
ATGCACATTCAACCACTTCTGCXX\
Edits in Original Sequence 
GGGCCCCCCTCGAGTTTTTTTTTTTTTTTTTTAATGAACAATCCATTTTTCTTCACCTTAGCTCGTGAATGAGTTCTCCACATAAACCAA
AGAGGCCTTTTTTTCAAAATTCACTACACATA
(5')ATGAAGAATGAAAAGATAAATAACCCAGACAAGTTGGCCAATAATAGCgCCCTC
TAATGTACAGTTTGTTATAACAATAAACATAATTGGTXCTGCAGATACTACCGATACTCCACCAGCACATACAATGGCTTGCCATTCAAC
TTCTCCTTACCCTTTAGTTCTGGTATTTCAATCACACATGCACATTCAACCACTTCTGCXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan