ESTScan Details for Unigene SGN-U225841

Score 
32
Direction 
Forward
Predicted Peptide Sequence 
LMGSGEGRXVGRPYHYLVEVERLYYNLKFLAGKKLWMHCLQAF
Predicted Coding Sequence 
XCACTAATGGGGTCTGGGGAGGGTAGAGXTGTAGGCAGACCTTACCACTACCTCGTGGAGGTAGAGAGGCTGTATTACAATCTCAAATTC
CTCGCTGGTAAGAAACTATGGATGCACTGCTTGCAAGCATTTTGA\
Edits in Original Sequence 
(5')XCACTAATGGGGTCTGGGGAGGGTAGAGXTGTAGGCAGACCTTACCACTACCTCGTGGAGGTAGAGAGGCTGTATTACAATCTCAA
ATTCCTCGCTGGTAAGAAACTATGGATGCACTGCTTGCAAGCATTTTGA\(3')AGTTTGTCTTAGTAAGCTAAAGCCATGACCTTTTAT
CTTAGATTTAATTAAAGTATTGAGACACAGTAACTTCTCTACATGTTTGAATTTCTTTTGGTTAGGTTCTACATCAAACGTATATAAGTT
TATTTTGTATCGCCTCTTTATGGACTTCAAATACTGAGCTTTAATTGCTCCTATGACATTAAAAATATTTAATGCGTAAATTGTTGGAAT
AATATTGTTGCATTTGGCTTTAGTGTCTGGTTGTGGAAATTCTTCTCCATGGAAGCAAACCGACTGAATTAGCTATGTGCAAAGAATTAA
CTGGTAAAAAATAGTTAAACCATTATCTTTTCTATCTCTCAACCTATACTTGCAGAGCATAGGTGATCTCAAGTTCCAGATAATGGAAGA
TCGTTGACAGGCAGCGTAAATAGTCAAATTCCAACAATTCATATAACCGACTCAATTTTGTTCAAAAAAAATAAATTGATGGATCGCTTC
TATATAGCTGCTGTAAAAGCACTAATATTGGAGTAGCATTATTTGGGGCCTTCAGTGTTGTATGTGGAGAAAGCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan