ESTScan Details for Unigene SGN-U225843

Score 
1017
Direction 
Forward
Predicted Peptide Sequence 
VYNIVTKKMVVSSTDEFQATVQKSYDKMSELKAFDDTKAGVKGLVDAGITKVPQIFILPPNNRTESLDTSEKQFIFPVIDFEGIDEDPIK
RKEIVGKVRDASETWGFFQVVNHGIPTSVLEGMLQGTREFFEQDIEVKKQYYTRDIMKKVVHNSNFDLYSPSVPAANWRDSFCFSMAPNP
PSPEEXSKTMQGNTNGLLQECDGIGLFLAWIIVKGLGLDPCHLEDMDCVKGLGVVGHYYPPCPQPELTIGTNTHSDNDFITVLLQDHIGG
LQVLHQNQWVDIPPTSAALVVNIGDLLQLISNDKYTSVEHRVLSNKVGPRISVASFFTTGPFPSPKLYGPIAELLSEDNPPKYRATTVTD
YSX
Predicted Coding Sequence 
XTTGTTTATAACATCGTAACAAAGAAGATGGTAGTCTCTAGCACCGATGAATTTCAGGCCACAGTTCAGAAAAGTTATGACAAAATGAGT
GAGTTAAAAGCCTTTGATGATACAAAGGCTGGTGTCAAAGGACTCGTTGATGCTGGAATCACTAAAGTACCTCAAATATTCATTCTACCA
CCAAATAACAGGACGGAGTCCTTGGATACAAGTGAAAAACAGTTCATTTTCCCAGTCATAGACTTTGAAGGTATTGACGAGGACCCAATA
AAGCGTAAAGAGATTGTGGGAAAAGTTCGAGATGCATCGGAGACATGGGGTTTCTTCCAAGTGGTAAATCATGGCATTCCAACATCTGTT
CTGGAAGGAATGCTGCAAGGAACACGTGAGTTTTTTGAGCAAGATATAGAGGTTAAGAAACAATATTACACTCGAGATATCATGAAGAAG
GTGGTTCATAATAGCAATTTTGATTTGTATAGCCCTTCGGTTCCAGCTGCAAATTGGAGAGACTCCTTTTGCTTTTCAATGGCTCCTAAT
CCTCCCAGTCCAGAAGAAXTTTCCAAGACCATGCAGGGAAATACTAATGGATTACTCCAAGAATGTGATGGAATTGGGCTGTTCCTTGCT
TGGATTATTGTCAAAGGTCTCGGTCTTGATCCTTGTCATCTCGAAGATATGGATTGCGTGAAGGGGCTCGGTGTTGTGGGCCATTACTAT
CCACCATGCCCTCAACCAGAACTCACCATAGGCACCAATACACATTCTGATAATGATTTTATCACAGTGCTTCTACAAGATCATATCGGA
GGACTCCAAGTCCTTCACCAGAATCAGTGGGTTGATATTCCTCCTACATCTGCTGCTCTTGTGGTGAATATTGGAGATCTTTTGCAGCTC
ATTTCAAATGACAAGTACACAAGTGTTGAACACAGAGTATTGTCAAATAAAGTTGGACCAAGAATATCAGTTGCAAGCTTCTTCACTACT
GGTCCATTTCCATCTCCGAAGCTCTATGGACCAATTGCTGAATTGTTATCAGAAGATAATCCTCCGAAATATCGTGCAACCACAGTGACG
GACTATAGTGXX\
Edits in Original Sequence 
(5')XTTGTTTATAACATCGTAACAAAGAAGATGGTAGTCTCTAGCACCGATGAATTTCAGGCCACAGTTCAGAAAAGTTATGACAAAAT
GAGTGAGTTAAAAGCCTTTGATGATACAAAGGCTGGTGTCAAAGGACTCGTTGATGCTGGAATCACTAAAGTACCTCAAATATTCATTCT
ACCACCAAATAACAGGACGGAGTCCTTGGATACAAGTGAAAAACAGTTCATTTTCCCAGTCATAGACTTTGAAGGTATTGACGAGGACCC
AATAAAGCGTAAAGAGATTGTGGGAAAAGTTCGAGATGCATCGGAGACATGGGGTTTCTTCCAAGTGGTAAATCATGGCATTCCAACATC
TGTTCTGGAAGGAATGCTGCAAGGAACACGTGAGTTTTTTGAGCAAGATATAGAGGTTAAGAAACAATATTACACTCGAGATATCATGAA
GAAGGTGGTTCATAATAGCAATTTTGATTTGTATAGCCCTTCGGTTCCAGCTGCAAATTGGAGAGACTCCTTTTGCTTTTCAATGGCTCC
TAATCCTCCCAGTCCAGAAGAAXTTTCCAAGACCATGCAGGGAAATACTAATGGATTACTCCAAGAATGTGATGGAATTGGGCTGTTCCT
TGCTTGGATTATTGTCAgAAGGTCTCGGTCTTGATCCTTGTCATCTCGAAGATATGGATTGCGTGAAGGGGCTCGGTGTTGTGGGCCATT
ACTATCCACCATGCCCTCAACCAGAACTCACCATAGGCACCAATACACATTCTGATAATGATTTTATCACAGTGCTTCTACAAGATCATA
TCGGAGGACTCCAAGTCCTTCACCAGAATCAGTGGGTTGATATTCCTCCTACATCTGCTGCTCTTGTGGTGAATATTGGAGATCTTTTGC
AGCTCATTTCAAATGACAAGTACACAAGTGTTGAACACAGAGTATTGTCAAATAAAGTTGGACCAAGAATATCAGTTGCAAGCTTCTTCA
CTACTGGTCCATTTCCATCTCCGAAGCTCTATGGACCAATTGCTGAATTGTTATCAGAAGATAATCCTCCGAAATATCGTGCAACCACAG
TGACGGACTATAGTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan