ESTScan Details for Unigene SGN-U225862

Score 
377
Direction 
Forward
Predicted Peptide Sequence 
MKVSQVSDQINTQLNNSNQGNGMTIFAPTDNAFSSLKSGTINTLSAQQQVQLVQFHVLPNFISMSQFQTISNPLRTQAGDSTPGDFPLNV
TTSGNQVNVSTGVDDATIANTIYTDGQLAVYQVDKVLQPMSIFAAPAPAMAPTPATLKPKSKSPAGLNPTSGNDDLPAAENSGVERIAMH
GTTGFVFWNFF
Predicted Coding Sequence 
ATGAAAGTATCACAAGTTAGTGATCAAATCAACACACAATTAAACAATTCAAATCAAGGGAATGGGATGACTATTTTTGCACCAACAGAT
AATGCATTTTCTAGCCTAAAATCAGGCACAATAAATACACTAAGTGCACAACAACAAGTTCAATTGGTGCAATTTCATGTTTTACCAAAT
TTCATTTCAATGTCACAATTTCAAACTATTAGTAACCCTTTGAGAACACAAGCTGGTGATTCTACTCCCGGAGACTTCCCGTTAAACGTA
ACGACGTCCGGTAATCAAGTCAATGTCTCTACCGGAGTTGATGATGCTACTATTGCTAACACAATTTATACTGATGGTCAGCTTGCTGTT
TATCAGGTTGATAAAGTGCTTCAACCTATGAGTATCTTTGCTGCTCCGGCTCCGGCAATGGCACCGACTCCGGCAACGTTGAAACCAAAG
AGCAAGTCTCCGGCAGGATTGAACCCTACCTCCGGCAACGACGACTTGCCGGCGGCGGAGAATTCCGGTGTTGAGAGGATTGCCATGCAC
GGCACAACGGGNTTTGTTTTTTGGAATTTCTTT\
Edits in Original Sequence 
AAGAACTACATCATTTCCTTCTTGAATTTTTTTTATTTTTTTTTAAAAAAATGAAACACCAAATTATTTTTTTAATTATTATCATCCTCC
AATTTTCAACCTTAACACTATCTCAAACACCCCCTTCTGGTCCAACAAACATCACACAAATCCTAGAAAAAGCAGGCCAATTCACAACAT
TAATTAGACTA
(5')ATGAAAGTATCACAAGTTAGTGATCAAATCAACACACAATTAAACAATTCAAATCAAGGGAATGGGATGACTATT
TTTGCACCAACAGATAATGCATTTTCTAGCCTAAAATCAGGCACAATAAATACACTAAGTGCACAACAACAAGTTCAATTGGTGCAATTT
CATGTTTTACCAAATTTCATTTCAATGTCACAATTTCAAACTATTAGTAACCCTTTGAGAACACAAGCTGGTGATTCTACTCCCGGAGAC
TTCCCGTTAAACGTAACGACGTCCGGTAATCAAGTCAATGTCTCTACCGGAGTTGATGATGCTACTATTGCTAACACAATTTATACTGAT
GGTCAGCTTGCTGTTTATCAGGTTGATAAAGTGCTTCAACCTATGAGTATCTTTGCTGCTCCGGCTCCGGCAATGGCACCGACTCCGGCA
ACGTTGAAACCAAAGAGCAAGTCTCCGGCAGGATTGAACCCTACCTCCGGCAACGACGACTTGCCGGCGGCGGAtGAATTCCGGTGTTGA
GAGGATTGCCATGCACGGCACAACGGGNTTTGTTTTTTGGAATTTCTTT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan