ESTScan Details for Unigene SGN-U225902

Score 
497
Direction 
Forward
Predicted Peptide Sequence 
MERLRCQRIGCNATFTEDDNPEGSCTYHESGPLFHDGMKQWSCCKKKSHDFSLFLEIPGCKTGKHTTEKPVIATPSATKNKAVPVPVRVP
APMTNASPKKPVLDATRDSFVLIMVHDPXEAIPKASNTVTSLPSESNTVVQQDHPAPVKKKIDINEPQICKNKSCGKTFTEKENHDTACN
YHPGPAIFHDRMKGWKCCDVHVKEFDEFMTIPPCTKGWHNSDPVS
Predicted Coding Sequence 
ATGGAGAGACTTCGATGTCAGAGGATCGGTTGTAACGCTACCTTCACTGAGGATGATAATCCTGAAGGCTCATGCACTTATCACGAATCC
GGTCCTTTATTTCATGATGGAATGAAGCAGTGGAGTTGTTGCAAGAAAAAAAGTCATGATTTCAGTTTATTTCTTGAAATTCCTGGGTGT
AAGACAGGAAAGCACACAACAGAAAAACCAGTGATTGCAACACCATCTGCTACCAAAAATAAAGCAGTTCCTGTGCCAGTGCGTGTGCCA
GCTCCTATGACCAATGCATCACCAAAGAAGCCTGTTCTAGATGCCACCAGGGATTCTTTTGTTCTGATCATGGTTCACGACCCAGAXGAA
GCAATTCCAAAAGCATCAAATACAGTAACATCTCTACCTTCTGAGAGCAATACAGTTGTACAGCAAGACCATCCAGCTCCAGTGAAAAAG
AAAATTGATATAAATGAGCCCCAAATTTGTAAAAACAAGAGCTGCGGTAAGACCTTTACAGAAAAGGAAAATCACGACACTGCTTGTAAT
TACCATCCCGGCCCCGCTATCTTCCATGACCGGATGAAAGGATGGAAATGCTGTGATGTTCATGTCAAAGAATTTGACGAGTTCATGACC
ATACCTCCATGCACCAAAGGATGGCACAACAGTGACCCAGTGTCCTAA\
Edits in Original Sequence 
TTTTCTAGAGAATTAGCA(5')ATGGAGAGACTTCGATGTCAGAGGATCGGTTGTAACGCTACCTTCACTGAGGATGATAATCCTGAAGG
CTCATGCACTTATCACGAATCCGGTCCTTTATTTCATGATGGAATGAAGCAGTGGAGTTGTTGCAAGAAAAAAAGTCATGATTTCAGTTT
ATTTCTTGAAATTCCTGGGTGTAAGACAGGAAAGCACACAACAGAAAAACCAGTGATTGCAACACCATCTGCTACCAAAAATAAAGCAGT
TCCTGTGCCAGTGCGTGTGCCAGCTCCTATGACCAATGCATCACCgAAAGAAGCCTGTTCTAGATGCCACCAGGGATTCTTTTGTTCTGA
TCATGGTTCACGACCCAGAXGAAGCAATTCCAAAAGCATCAAATACAGTAACATCTCTACCTTCTGAGAGCAATACAGTTGTACAGCAAG
ACCATCCAGCTCCAGTGAAAAAGAAAATTGATATAAATGAGCCCCAAATTTGTAAAAACAAGAGCTGCGGTAAGACCTTTACAGAAAAGG
AAAATCACGACACTGCTTGTAATTACCATCCCGGCCCCGCTATCTTCCATGACCGGATGAAAGGATGGAAATGCTGTGATGTTCATGTCA
AAGAATTTGACGAGTTCATGACCATACCTCCATGCACCAAAGGATGGCACAACAGTGACCCAGTGTCCTAA\(3')TAGACAGGTTCATG
AATGAGCCACACATGAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan