ESTScan Details for Unigene SGN-U225929

Score 
206
Direction 
Forward
Predicted Peptide Sequence 
KRSSGLKNLQFAGDCSSENPVSTVPXDLSVVXILKHPTSSHLMSRKRNVIVATGLLVFASAGLSFPFYMASRSSRATPVIDSSKPLPPQA
TFRGPYINTGSRDIGPDHQTYPKKXTSFLIDISFAVIEVTLDFPFFFLFNEKNNNXESVETGSGEISMFESDPGXTLAGLDTIVIENSGG
NLHVESVIEERPI
Predicted Coding Sequence 
XXGAAGAGATCATCGGGGCTGAAAAACCTTCAGTTCGCCGGCGATTGTTCGTCGGAGAACCCTGTTTCCACAGTTCCAXTAGATTTATCA
GTTGTTAXGATACTTAAACATCCTACTTCATCTCACTTGATGTCTCGGAAACGCAATGTCATTGTTGCCACAGGCTTGCTAGTCTTTGCA
TCTGCTGGCTTATCCTTTCCGTTTTACATGGCGTCAAGATCATCAAGGGCAACTCCAGTCATTGATTCATCAAAGCCATTGCCACCCCAG
GCGACATTTCGTGGCCCTTACATCAACACGGGATCGCGTGATATTGGACCTGATCATCAAACATACCCTAAGAAAXTAACATCTTTCTTG
ATTGATATTAGTTTTGCTGTTATTGAAGTCACTCTAGATTTCCCCTTTTTCTTTCTATTCAATGAAAAGAATAATAATGAXGAGTCTGTT
GAAACTGGCTCAGGAGAAATTAGCATGTTTGAGAGTGATCCAGGAGXCACCCTAGCTGGCCTGGACACCATTGTTATCGAAAACTCTGGA
GGAAATTTGCATGTTGAGAGTGTGATCGAGGAGCGTCCTATCTAG\
Edits in Original Sequence 
(5')XXGAAGAGATCATCGGGGCTGAAAAACCTTCAGTTCGCCGGCGATTGTTCGTCGGAGAACCCTGTTTCCACAGTTCCAXTAGATTT
ATCtAGTTGTTAXGATACTTAAACATCCTACTTCATCTCACTTGATGTCTCGGAAACGCAATGTCATTGTTGCCACAGGCTTGCTAGTCT
TTGCATCTGCTGGCTTATCCTTTCCGTTTTACATGGCGTCAAGATCATCAAGGGCAACTCCAGTCATTGATTCATCAAAGCCATTGCCAC
CCCAGGCGACATTTCGTGGCCCTTACATCAACACGGGATCGCGTGATATTGGACCTGATCATCAAACATACCCTAAGAAAXTAACATCTT
TCTTGATTaGATATTAGTTTTGCTaGTTATTGAAGTCACTCTAGATTTCCCCTTTTTCTTTCTATTCAATGAAAAGAgATAATAATGAXG
AGTCTGTTGAAACTGGCTCAGGAGAAATTAGCATGTTTGAGAGTGATCCAGGAGXCACCCTAGCTGGCCTGGACACCATTGTTATCGAAA
ACTCTGGAGGAAATTTGCATGtTTGAGAGTGTGATCGAGGAGCGTCCTATCTAG\(3')CTTGGACACTACTGTTTCAAGAAAAATTGTT
CTTTTAGAGATTTTCAGATATGTAAGTGTGATGTTGCTTTATTGTTCAGAAACAACAATATGTAATATGCTGCGTGGAACGGGGCTAGAA
TTTTCAGTAAGAAGTTTGAAAATGAGGGTAAAAAGAAAGGGAAAATTGAATTTTTTTTCCCCCCCTCTTTTTAATGATTTGGTTTAAATG
GAAGAAGGCACTTACTTTCATACCAAATTCAAGTAAAAGAAAAGGAAAACATTGGTGGGAATTGGGAATAGAACTAGATTTTTTTTTATG
AATAGAAAAAAAAAGCAAAGAAGAAAATTGTTGCTACTAGGGCGTGTTTTGACATATTTTCCATATTTGGTTGGTGAATCTTTTAAGAAA
ATGACTCTTTTATTAAAAAAAAAAAAAAAAAAAACTCGAGGGGGGCCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan