ESTScan Details for Unigene SGN-U225954

Score 
458
Direction 
Forward
Predicted Peptide Sequence 
MWLACSLCQPKIAIFVTPNEEGAEFTTPLIPKSWIITLKSELDXETQEISENMMTATMTTTVSVGSSSFFTNYPLMSALIAFALAQSIKL
FTSWYKERRWDLKQLVGSGGMPSSHSSTVTALAVAVGLQEGFGGALFACALVLACVVMYDATGVRLHAGRQAEVLNQILYELPSEHPLAD
SRPLRELLGHTPPQVVAGGLLGLTTA
Predicted Coding Sequence 
ATGTGGTTGGCTTGTTCGTTGTGTCAACCCAAAATAGCGATTTTCGTCACACCAAACGAAGAAGGAGCAGAATTCACAACACCTCTTATT
CCCAAATCTTGGATTATAACTTTGAAATCTGAACTTGATXTTGAAACTCAAGAAATTAGTGAAAATATGATGACAGCTACCATGACAACA
ACGGTCTCTGTTGGGTCATCTTCATTTTTCACTAATTATCCTCTTATGTCTGCTCTTATTGCCTTTGCTCTTGCCCAATCCATCAAGCTC
TTCACTTCATGGTACAAGGAAAGACGATGGGATCTTAAGCAACTTGTTGGATCTGGTGGAATGCCCTCATCCCATTCATCAACAGTAACT
GCTCTAGCTGTGGCTGTTGGTTTGCAAGAGGGCTTTGGGGGGGCGCTCTTTGCTTGTGCATTAGTTTTAGCGTGTGTGGTCATGTATGAT
GCCACGGGTGTAAGATTACATGCTGGACGTCAGGCAGAGGTCCTGAATCAAATTTTATACGAACTTCCTTCTGAACATCCTCTTGCAGAT
AGTAGGCCATTACGAGAACTCCTTGGTCACACTCCTCCTCAGGTTGTAGCTGGTGGATTATTGGGATTGACAACTGCX\
Edits in Original Sequence 
TTGTGTTTTTTTTTTTTTTTCGTTTAGTTTTGAGACTTGAAAGCTTATATTGGATCTCGGAATTAAATACAGATTGCTCATTGCATGATT
CATTTGAAGTGGGCTTGCATCAACTTTTTTTTGATATTCGATCTTGAACCCGATAACTCTTGTTAACGGTAAAAGTAATGTCTTCTATTT
TGTATTGTTGGTGTTACTAAATATAGTCACCTACCCTTCCATAAATTGAAATATTGAAATTGGGGATGCAAAAGAATATTCTTCAAGTCT
TTGATGAAACC
(5')ATGTGGTTGGCTTGTTCGTTGTGTCAACCCAAAATAGCGATTTTCGTCACACgCAAACGAAGAAGGAGCAGAATT
CACAACACCTCTTATTCCCAAATCTTGGATTATAACTTTGAAATCTGAAtCTTGATXTTGAAACTCAAGAAATTAGTGAAAATATGATGA
CAGCTACCATGACAACAACGGTCTCTGTTGGGTCATCTTCATTTTTCACTAATTATCCTCTTATGTCTGCTCTTATTGCCTTTGCTCTTG
CCCAATCCATCAAGCTCTTCACTTCATGGTACAAGGAAAGACGATGGGATCTTAAGCAACTTGTTGGATCTGGTGGAATGCCCTCATCCC
ATTCATCAACAGTAACTGCTCTAGCTGTGGCTGTTGGTTTGCAAGAGGGCTTTGGGGGGGCGCTCTTTGCTTGTGCATTAGTTTTAGCGT
GTGTGGTCATGTATGATGCCACGGGTGTAAGATTACATGCTGGACGTCAGGCAGAGGTCCTGAATCAAATTTTATACGAACTTCCTTCTG
AACATCCTCTTGCAGATAGTAGGCCATTACGAGAACTCCTTGGTCACACTCCTCCTCAGGTTGTAGCTGGTGGATTATTGGGATTGACAA
CTGCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan