ESTScan Details for Unigene SGN-U225981

Score 
358
Direction 
Forward
Predicted Peptide Sequence 
GTPQFGGSAKAKDALWQRMSGCMDQLHSIVVAVWHLQRVLSKKRDPFTHVLLLDEVMQEGDPILTDRVWEALGKSFANQMKSTFSTSSFV
KEIFTLGYPKLFSMLENLLERISRDTDVKGVPPALSSEAKDQMLSSIEIFQTAFLTLCLSRLSELVNTVFPVSGRGTVPSKDHIARIISR
IQEEIEAVQMDAQLTLLVLREINKVLLLLSERTEYQISAGPEARQITGPATPAQVKNFALCQHLQEIHTRISSMVAGLPAIATDILSPAL
GSIYGVAGDSVTPLFXXHADRLESCILX
Predicted Coding Sequence 
GGGACACCACAGTTTGGGGGAAGTGCAAAGGCGAAGGATGCATTATGGCAAAGGATGAGTGGTTGTATGGACCAATTGCATTCCATTGTG
GTTGCTGTTTGGCATTTGCAGAGGGTTTTATCGAAGAAAAGAGACCCCTTTACGCATGTCTTGCTGCTTGATGAGGTCATGCAGGAAGGT
GATCCGATATTGACGGATCGTGTTTGGGAGGCACTGGGTAAATCTTTTGCTAACCAAATGAAGTCCACTTTCAGCACATCAAGTTTTGTT
AAGGAGATATTCACTCTTGGATATCCAAAACTCTTCTCTATGTTAGAAAACCTGCTTGAAAGAATTTCACGTGATACAGACGTCAAAGGA
GTTCCACCAGCTCTCAGTTCAGAAGCAAAGGACCAAATGTTATCTTCCATTGAAATATTCCAGACTGCTTTCCTAACCCTCTGTCTGAGC
CGTCTTTCAGAACTTGTTAATACTGTATTTCCAGTGTCCGGTCGTGGAACTGTTCCTTCAAAAGATCACATAGCAAGGATTATATCACGA
ATTCAAGAAGAAATAGAAGCCGTCCAGATGGATGCTCAGTTAACTCTTCTTGTCTTGCGTGAGATCAACAAAGTTCTGCTTCTGCTTTCA
GAAAGAACAGAATACCAGATATCTGCAGGTCCCGAGGCACGACAGATAACAGGTCCTGCAACTCCAGCACAGGTGAAGAACTTTGCGTTA
TGCCAGCATCTGCAAGAAATTCATACCCGCATATCGTCTATGGTGGCAGGATTACCAGCTATTGCAACCGATATTTTGTCTCCCGCACTG
GGATCTATCTATGGGGTTGCAGGTGATTCAGTGACACCACTATTCCANNNTCATGCTGATCGACTGGAGTCATGCATCTTGCXX\
Edits in Original Sequence 
(5')GGGACACCACAGTTTGGGGGAAGTGCAAAGGCGAAGGATGCATTATGGCAAAGGATGAGTGGTTGTATGGACCAATTGCATTCCAT
TGTGGTTGCTGTTTGGCATTTGCAGAGGGTTTTATCGAAGAAAAGAGACCCCTTTACGCATGTCTTGCTGCTTGATGAGGTCATGCAGGA
AGGTGATCCGATATTGACGGATCGTGTTTGGGAGGCACTGGGTAAATCTTTTGCTAACCAAATGAAGTCCACTTTCAGCACATCAAGTTT
TGTTAAGGAGATATTCACTCTTGGATATCCAAAACTCTTCTCTATGTTAGAAAACCTGCTTGAAAGAATTTCACGTGATACAGACGTCAA
AGGAGTTCCACCAGCTCTCAGTTCAGAAGCAAAGGACCAAATGTTATCTTCCATTGAAATATTCCAGACTGCTTTCCTAACCCTCTGTCT
GAGCCGTCTTTCAGAACTTGTTAATACTGTATTTCCAGTGTCCGGTCGTGGAACTGTTCCTTCAAAAGATCACATAGCAAGGATTATATC
ACGAATTCAAGAAGAAATAGAAGCCGTCCAGATGGATGCTCAGTTAACTCTTCTTGTCTTGCGTGAGATCAACAAAGTTCTGCTTCTGCT
TTCAGAAAGAACAGAATACCAGATATCTGCAGGTCCCGAGGCACGACAGATAACAGGTCCTGCAACTCCAGCACAGGTGAAGAACTTTGC
GTTATGCCAGCATCTGCAAGAAATTCATACCCGCATATCGTCTATGGTGGCAGGATTACCAGCTATTGCAACCGATATTTTGTCTCCCGC
ACTGGGATCTATCTATGGGGTTGCAGGTGATTCAGTGACACCACTATTCCANNNTCATGCTGATCGACTGGAGTCATGCATCTTGCXX\
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan