ESTScan Details for Unigene SGN-U226029

Score 
-85
Direction 
Reverse
Predicted Peptide Sequence 
YVDRLTKSAXLHSGSDVVYGRKVSRAIYQSDCSNTWSSYFYHIRSRFTIYISILEGITTWSVYSVRYEYNISPQTDGQSERTMQVLEDML
RACVIDFGARWDQHLSLAEFGYNNSYHSSIHMAPFEALYGRRCRSPIGWFDSAKMDSLDTNLLRDAXVASPYDSVDYXTVQSRQSYADQG
IRALVFMEGDHVWLRVSPMKGVMRFGKKGKFSPRFIGPFEILSRVGEELVVHPVFHVSMLRKFISDESHVLSLX
Predicted Coding Sequence 
XGTTATGTTGATAGGCTGACCAAGTCTGCTXCACTTCATTCCGGTTCGGATGTAGTATACGGCAGAAAAGTTAGTCGAGCTATATATCAG
TCAGATTGTTCGAATACATGGAGTTCGTATTTTTATCATATCAGATCGAGGTTCACTATTTACATCTCAATTCTTGAAGGCATTACAACA
TGGTCTGTGTACTCAGTTAGATATGAGTACAACATTTCCCCTCAAACAGATGGTCAATCTGAGCGGACCATGCAAGTATTGGAAGATATG
CTTCGAGCGTGTGTGATCGATTTTGGTGCTAGATGGGATCAACATTTATCCTTAGCGGAGTTTGGCTATAATAACAGTTATCACTCTAGT
ATCCATATGGCCCCATTTGAGGCGTTGTATGGAAGACGGTGTAGGTCTCCGATTGGTTGGTTTGATTCGGCGAAGATGGACTCTTTGGAT
ACAAACTTGCTTAGAGATGCTXATGTAGCAAGTCCGTATGATTCAGTAGATTATXTGACAGTTCAGAGTCGACAGAGTTATGCAGATCAG
GGAATTAGAGCCTTAGTGTTTATGGAGGGTGATCATGTTTGGCTCCGAGTATCACCCATGAAGGGTGTGATGAGGTTTGGAAAAAAGGGC
AAGTTTAGCCCTAGATTCATTGGACCTTTTGAGATTTTGAGCCGAGTAGGAGAGGAGCTTGTAGTTCATCCTGTTTTTCATGTCTCTATG
CTTCGGAAGTTTATTTCGGATGAATCTCATGTGCTTTCACTTGAX\
Edits in Original Sequence 
(5')XGTTATGTTGATAGGCTGACCAAGTCTGCTXCACTTCATTCCGGTTCGGATGTAGTATACGGCAGAAAAGTTAGTCGAGCTATATA
TCAGTCAGATTGTTCGAATACATGGAGTTCGTATTTTTATCATATCAGATCGAGGTTCACTATTTACATCTCAATTCTTGAAGGCATTAC
AACATGGTCTGTGTACTCAGTTAGATATGAGTACAACATTTCaCCCTCAAACAGATGGTCAATCTGAGCGGACCATGCAAGTATTGGAAG
ATATGCTTCGAGCGTGTGTGATCGATTTTGGTGCTAGATGGGATCAACATTTATCCTTAGCGGAGTTTGGCTATAATAACAGTTATCACT
CTAGTATCCATATGGCCCCATTTGAGGCGTTGTATGGAAGACGGTGTAGGTCTCCGATTGGTTGGTTTGATTCGGCGAAGATGGACTCTT
TGGATACAAACTTGCTTAGAGATGCTXATGTAGCAAGTCCGTATGATTCAGTAGATTATXTGACAGTTCAGAGTCGACAGAGTTATGCAG
ATCAGGGAATTAGAGCCTTAGTGTTTATGGAGGGTGATCATGTTTGGCTCCGAGTATCACCCATGAAGGGTGTGATGAGGTTTGGAAAAA
AGGGCAAGTTTAGCCCTAGATTCATTGGACCTTTTGAGATTTTGAGCCGAGTAGGAGAGGtAGCTTGTAGTTCATCCTGTTTTTCATGTC
TCTATGCTTCGGAAGTTTATTTCGGATGAATCTCATGTGCTTTCACTTGAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan