ESTScan Details for Unigene SGN-U226108

Score 
412
Direction 
Forward
Predicted Peptide Sequence 
DSFKPRNVKGSTVKTQIWSDKEEENSEEYEYLAPDGVVYKRTLRLVEGAMFAAVSGLAYLLSNSLAIENYFGCFFALPIVVSSMRWGVAA
GRKTMVATVVLLFVLSGPVKALNYMLMHGLLGFTMGSLWRLRTSWGASIFLCALARAVGALGYVILSSFLIGENILALITINIHASLSYI
LTSLGXSDTSIYELYIHLIRDSAFDKLCIFRVLAASSHAIFLTKFGMKANXETAKVVSHSNXKQAKESTLIKDAVGMELCSDTTPPRWLT
QGYFDHHLFKTVDLNRHQLHLSIAQNNXKVSNKSSLLVHEFEMRIWPVSNALKTPPGW
Predicted Coding Sequence 
GACAGTTTTAAGCCAAGAAATGTGAAAGGTTCAACTGTAAAAACCCAAATTTGGAGTGATAAAGAAGAGGAAAATTCAGAGGAGTATGAG
TACTTAGCTCCAGATGGGGTTGTTTATAAGAGGACTTTGAGACTAGTAGAAGGTGCTATGTTTGCTGCTGTTTCAGGATTGGCTTATCTA
TTGAGCAATTCTCTTGCTATTGAGAATTACTTCGGCTGTTTCTTCGCATTGCCAATTGTTGTATCCTCGATGAGATGGGGTGTCGCAGCT
GGCAGGAAAACCATGGTGGCAACTGTTGTACTCTTGTTTGTCTTGTCTGGTCCAGTGAAAGCATTAAATTATATGCTAATGCATGGTTTA
CTTGGCTTCACAATGGGTTCGTTATGGAGGTTGAGAACAAGTTGGGGTGCCTCGATCTTCTTGTGTGCTCTTGCTCGGGCTGTTGGTGCT
CTCGGATATGTTATATTATCCTCATTTTTAATAGGAGAAAACATCCTTGCTCTGATCACGATAAACATTCATGCTTCTCTCTCGTACATC
CTCACATCCTTAGGCAGXTCCGATACTTCCATCTATGAACTTTATATACACCTTATTCGGGACTCTGCTTTTGATAAACTGTGCATTTTT
CGTGTCCTTGCTGCATCTTCTCATGCCATTTTTCTTACTAAATTTGGCATGAAAGCTAATXTTGAGACTGCCAAGGTGGTTAGCCATAGC
AATTTXAAACAGGCTAAAGAAAGCACTCTCATTAAAGACGCGGTAGGAATGGAACTTTGCTCAGATACTACACCACCGCGGTGGTTAACA
CAAGGTTATTTTGATCATCATTTATTCAAGACTGTCGATTTGAATCGACATCAACTTCATCTATCTATTGCTCAAAACAATXACAAAGTC
AGCAACAAGTCCAGTTTACTTGTACATGAATTTGAAATGCGTATTTGGCCAGTATCTAATGCACTGAAAACTCCACCTGGTTGG\
Edits in Original Sequence 
TTTTTTTTCCCACCATGAATGTCCTCAAACTTCATTACAATAGCAAATTCTCTTCAATTTCTGGGAATTTATCACCCCATTCATCTTTTT
TAGCACCCCATTTCATTTTTTTGCCTACCCACAAACCAAAAATTCTGCCTTTAGTTCTTAATTGTTCTCTT
(5')GACAGTTTTAAGCCA
AGAAATGTGAAAGGTTCAACTGTAAAAACCCAAATTTGGAGTGATAAAGAAGAGGAAAATTCAGAGGAGTATGAGTACTTAGCTCCAGAT
GGGGTTGTTTATAAGAGGACTTTGAGACTAGTAGAAGGTGCTATGTTTGCTGCTGTTTCAGGATTGGCTTATCTATTGAGCAATTCTCTT
GCTATTGAGAATTACTTCGGCTGTTTCTTCGCATTGCCAATTGTTGTATCCTCGATGAGATGGGGTGTCGCAGCTGGCAGGAAAACCATG
GTGGCAACTGTTGTACTCTTGTTTGTCTTGTCTGGTCCAGTGAAAGCATTAAATTATATGCTAATGCATGGTTTACTTGGCTTCACAATG
GGTTCGTTATGGAGGTTGAGAACAAGTTGGGGTGCCTCGATCTTCTTGTGTGCTCTTGCTCGGGCTGTTGGTGCTCTCGGATATGTTATA
TTATCCTCATTTTTAATAGGAGAAAACATCCTTGCTCTGATCACGATAAACATTCATGCTTCTCTCTCGTACATCCTCACATCCTTAGGC
AGXTCCGATACTTCCATCTATGAACTTTATATACACCTTATTCGGGACTCTGCTTTTGATAAACTGTGCATTTTTCGTGTCCTTGCTGCA
TCTTCTCtATGCCATTTTTCTTACTAAATTTGGCATGAAAGCTAATXTTGAGACTGCCAAGGTGGTTAGCCATAGCAATTTXAAACAGGC
TAAAGAAAGCACTCTCATTAAAGACGCGGTAGGAATGGAACTTTGCTCAGATACTACACCACCGCGGTGGTTAACACAAGGTTATTTTGA
TCATCATTTATTCAAGACTGTCGATTTGAATCGACATCAACTTCATCTATCTATTGCTCAAAACAATXACAAAGTCAGCAACAAGTCCAG
TTTACTTGTACATGAATTTGAAATGCGTATTTGGCCAGTATCTAATGCACTGAAAACTCCACCTGGTTGG\(3')AGATGTAATATTTTT
GTGTATAATGCTATCAATTTATCTAAAAAAAAACATATATTATTTCAGAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan