ESTScan Details for Unigene SGN-U226130

Score 
416
Direction 
Reverse
Predicted Peptide Sequence 
GWKKGTKITFPEKGDYEYGAAPGDLIFVIDEKPHAVFKRDGNDLVTNQKISLLDALTGKTISLTTLDGRELTIPIKEIVKPGQELIIQNE
GMPISKERGKKGNLKIKFDIKFPSRLNADQKSDXQKGAMQEY
Predicted Coding Sequence 
XCAGGTTGGAAGAAAGGCACAAAAATAACTTTTCCAGAGAAAGGGGACTATGAATATGGAGCTGCCCCGGGTGATCTTATTTTTGTGATT
GATGAAAAGCCACATGCTGTCTTCAAGAGGGATGGAAATGATCTAGTCACGAATCAGAAAATATCGTTACTGGATGCTCTCACTGGAAAA
ACTATCAGCTTGACTACTTTGGACGGAAGGGAACTCACAATACCAATCAAAGAAATCGTCAAACCAGGACAGGAGCTGATAATCCAAAAT
GAGGGAATGCCAATATCAAAGGAACGTGGCAAAAAAGGGAATTTGAAGATCAAGTTTGACATTAAATTTCCATCAAGGCTAAATGCAGAT
CAGAAATCTGATXCTCAGAAGGGTGCTATGCAGGAGTATTGA\
Edits in Original Sequence 
(5')XCAGGTTGGAAGAAAGGCACAAAAATAACTTTTCCAGAGAAAGGGGACTATGAATATGGAGCTGCCCCGGGTGATCTTATTTTTGT
GATTGATGAAAAGCCACATGCTGTCTTCAAGAGGGATGGAAATGATCTAGTCACGAATCAGAAAATATCGTTACTGGATGCTCTCACTGG
AAAAACTATCAGCTTGACTACTTTGGACGGAAGGGAACTCACAATACCAATCAAAGAAATCGTCAAACCAGGACAGGAGCTGATAATCCA
AAATGAGGGAATGCCAATATCAAAGGAACGTGGCAAAAAAGGGAATTTGAAGATCAAGTTTGACATTAAATTTCCATCAAGGCTAAATGC
AGATCAGAAATCTGATXCTCAGAAGGGTGCTATGCAGGAGTATTGA\(3')CTAGTCCTATTTTTAACTTAAGGTGTCACTAACACTATC
TTGGAGTTGCGCGGAATGTAAATATTTAACAAGCTTTCTGTAGAAATGAAATTGTACATATTAGGATATAATCTTAAGGATGCGTTCCAA
CATTTACAAATAGTAAGCACCAAAAGAGGAGCTAATGTAGCTACTTCTTTAGCTGCTTGCATTTTCTTTTGTTGGATGTAAAAGGAGTAA
GTAGTTTAATAGCTGTGTTGTTTGATTTGGAGGTGGATACTATATATTAAGTATTGTAGTTGCGAGTAGTGGCTCTAAAAAAAAAAAAAA
AAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan