ESTScan Details for Unigene SGN-U226324

Score 
1244
Direction 
Forward
Predicted Peptide Sequence 
MVGASLAGLQDHLKLAREYAVEGLYDTSVIFFDGAIAQINKHVNTLDDPLIRSKWMNVKKAISEETEVVKQLDAEKRSFKEVPMGRRPNS
PPISTKSSFVFQPLDEYPTSSGAPMDDPDVWRPPSRDTTRRPGRAGQGGMRKSPQDGAWARASTTRTGTTIRGGRTSGSTKAGTGVRSST
TGKKAPGKSAKSDSTDGEPEEGKSKKGQYEGPDADLAAMLERDVLDNSPGVRWDDVAGLSEAKRLLEEAGALPLWMPEYFQGIRRPWKGV
LMFGPPGTGKTLLANAVATECGTHLTMFIVPPWLQNGVGREKHGAALVDLARSDAPSTIFIDEIDSLCDAPGGSGEHESSRTVKYELLVQ
V
Predicted Coding Sequence 
ATGGTGGGTGCATCACTGGCAGGATTGCAAGATCATCTCAAATTGGCTAGAGAATATGCTGTTGAAGGTCTTTATGATACTTCCGTCATC
TTCTTCGATGGCGCAATTGCTCAAATCAATAAGCATGTAAACACACTTGATGATCCTTTGATTCGTTCAAAATGGATGAATGTAAAGAAA
GCCATTTCCGAAGAAACTGAGGTAGTGAAACAATTGGATGCCGAGAAAAGATCTTTTAAGGAGGTTCCTATGGGTAGACGTCCTAATTCA
CCTCCAATTTCAACCAAGTCGTCTTTTGTCTTTCAACCGCTTGATGAGTACCCCACCTCATCTGGTGCTCCAATGGATGACCCTGATGTT
TGGAGACCACCAAGTCGGGACACAACAAGAAGACCTGGAAGAGCAGGTCAGGGGGGTATGAGAAAGTCCCCACAAGATGGAGCGTGGGCT
CGTGCATCTACTACAAGGACTGGAACAACAATCCGTGGGGGAAGGACCAGTGGCTCTACTAAGGCTGGTACTGGGGTTCGATCTTCAACT
ACTGGGAAAAAAGCACCTGGAAAATCTGCAAAGTCCGACTCTACGGATGGTGAACCTGAAGAGGGGAAGAGTAAAAAAGGTCAGTACGAG
GGGCCTGATGCAGACCTGGCTGCTATGCTTGAGAGAGATGTCTTGGATAATAGCCCTGGTGTGAGATGGGACGATGTTGCTGGGTTAAGT
GAGGCCAAAAGACTTCTGGAGGAAGCAGGAGCTCTTCCACTGTGGATGCCAGAATATTTCCAGGGAATCAGGAGACCATGGAAGGGTGTT
CTTATGTTTGGGCCTCCTGGAACGGGGAAGACACTTTTGGCTAATGCTGTTGCTACCGAGTGTGGGACACATTTGACAATGTTTATTGTG
CCACCTTGGCTTCAAAATGGCGTGGGGAGAGAGAAGCATGGAGCGGCGCTTGTTGATCTTGCTCGCTCTGATGCTCCCAGTACAATTTTC
ATTGATGAGATTGATTCTCTTTGTGATGCCCCAGGGGGTTCAGGAGAGCATGAATCATCCCGAACGGTGAAGTATGAACTTCTTGTTCAG
GTX\
Edits in Original Sequence 
TTCGAATTTGTTTTTGTTTGCTGAATATTTGGAAACCCTAACATTTGGGGATTTGGTTTAAGGAAATTATCGACAGATTTGAGTTTTGAG
GAATTGATA
(5')ATGGTGGGTGCATCACTGGCAGGATTGCAAGATCATCTCAAATTGGCTAGAGAATATGCTGTTGAAGGTCTTTATGA
TACTTCCGTCATCTTCTTCGATGGCGCAATTGCTCAAATCAATAAGCATGTAAACACACTTGATGATCCTTTGATTCGTTCAAAATGGAT
GAATGTAAAGAAAGCCATTTCCGAAGAAACTGAGGTAGTGAAACAATTGGATGCCGAGAAAAGATCTTTTAAGGAGGTTCCTATGGGTAG
ACGTCCTAATTCACCTCCAATTTCAACCAAGTCGTCTTTTGTCTTTCAACCGCTTGATGAGTACCCCACCTCATCTGGTGCTCCAATGGA
TGACCCTGATGTTTGGAGACCACCAAGTCGGGACACAACAAGAAGACCTGGAAGAGCAGGTCAGGGGGGTATGAGAAAGTCCCCACAAGA
TGGAGCGTGGGCTCGTGCATCTACTACAAGGACTGGAACAACAATCCGTGGGGGAAGGACCAGTGGCTCTACTAAGGCTGGTACTGGGGT
TCGATCTTCAACTACTGGGAAAAAAGCACCTGGAAAATCTGCAAAGTCCGACTCTACGGATGGTGAACCTGAAGAGGGGAAGAGTAAAAA
AGGTCAGTACGAGGGGCCTGATGCAGACCTGGCTGCTATGCTTGAGAGAGATGTCTTGGATAATAGCCCTGGTGTGAGATGGGACGATGT
TGCTGGGTTAAGTGAGGCCAAAAGACTTCTGGAGGAAGCAGGAGCTCTTCCACTGTGGATGCCAGAATATTTCCAGGGAATCAGGAGACC
ATGGAAGGGTGTTCTTATGTTTGGGCCTCCTGGAACGGGGAAGACACTTTTGGCTAATGCTGTTGCTACCGAGTGTGGGACgACATTTGA
CAATGTTTATTGTGCCACCTTGGCTTCAAAATGGCGTGGGGAGAGAGAAcGCATGGAGCGGCGCTTGTaTGATCTTGCTCGCTCTGATGC
TCCCAGTACAATTTTCATTGATGAGATTGATTCTCTTTGTGATGCCCCAGGGGGTTCAGGAGAGCATGAATCATCCCGAACGGTGAAGTA
TGAACTTCTTGTTCAGGTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan