Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U226370

Score 
543
Direction 
Forward
Predicted Peptide Sequence 
YCKGHPDNSRLIEIDENESGEVVLPGGISIPNVSKSIKCDKGEHTRFGSDVLSFQQMSEQFNQEVSVNGKIPSGLFNTMFEFSGSWQKDA
AYTKTLAFDGVFITLYSVALEKSQMVLCDYVKKEVPSTWDPAALARFIEKFGTHVIVGIKMGGKDVIYMKQQHSSSLLPADVQKRLKTMA
DKRFSGANEQGGVESQQTRQNEKFEIREHRLRFADPNISGSYAHKEDTVCICKRRGGSDSRGLMHNQWLQSVDQEPDVISMSFIPITSLL
NGISGSGFLSHAINLYLRYKPX
Predicted Coding Sequence 
XXGTATTGTAAAGGTCATCCAGATAATAGTCGTTTAATTGAAATTGATGAAAATGAGAGTGGGGAGGTTGTGCTTCCTGGTGGAATTTCA
ATACCTAATGTGTCAAAATCTATCAAATGTGATAAAGGAGAACACACACGGTTTGGCTCTGATGTTCTTTCTTTCCAGCAGATGTCAGAG
CAGTTCAATCAGGAAGTATCCGTGAATGGTAAAATTCCTTCGGGGCTCTTCAATACTATGTTCGAGTTTTCTGGTTCTTGGCAGAAGGAT
GCTGCATACACTAAAACCCTTGCTTTTGATGGTGTGTTCATCACGTTGTACTCTGTTGCTCTAGAAAAATCTCAAATGGTGCTGTGTGAT
TATGTTAAAAAGGAAGTTCCATCAACATGGGATCCTGCAGCATTAGCAAGGTTTATTGAAAAATTTGGTACTCATGTCATTGTTGGTATA
AAGATGGGGGGAAAAGATGTAATATATATGAAACAACAGCACTCCTCATCGCTTCTGCCCGCTGACGTGCAAAAACGTTTGAAGACAATG
GCAGATAAGAGGTTTTCAGGTGCAAATGAACAAGGAGGAGTAGAATCGCAGCAGACACGTCAGAATGAGAAGTTTGAAATCAGGGAGCAC
CGACTGAGGTTTGCCGATCCCAATATATCAGGTTCATATGCACATAAGGAGGATACTGTTTGTATTTGCAAGAGGAGAGGTGGAAGTGAT
AGCAGAGGCCTGATGCATAATCAGTGGTTACAAAGTGTTGATCAGGAGCCTGATGTGATCTCAATGTCCTTCATTCCTATAACTTCACTG
TTGAATGGCATCTCAGGAAGTGGATTTTTAAGTCATGCTATAAATCTGTACTTACGCTATAAACCACXX\
Edits in Original Sequence 
(5')XXGTATTGTAAAGGTCATCCAGATAATAGTCGTTTAATTGAAATTGATGAAAATGAGAGTGGGGAGGTTGTGCTTCCTGGTGGAAT
TTCAATACCTAATGTGTCAAAATCTATCAAATGTGATAAAGGAGAACACACACGGTTTGGCTCTGATGTTCTTTCTTTCCAGCAGATGTC
AGAGCAGTTCAATCAGGAAGTATCCGTGAATGGTAAAATTCCTTCGGGGCTCTTCAATACTATGTTCGAGTTTTCTGGTTCTTGGCAGAA
GGATGCTGCATACACTAAAACCCTTGCTTTTGATGGTGTGTTCATCACGTTGTACTCTGTTGCTCTAGAAAAATCTCAAATGGTGCTGTG
TGATTATGTTAAAAAGGAAGTTCCATCAACATGGGATCCTGCAGCATTAGCAAGGTTTATTGAAAAATTTGGTACTCATGTCATTGTTGG
TATAAAGATGGGGGGAAAAGATGTAATATATATGAAACAACAGCACTCCTCATCGCTTCTGCCCGCTGACGTGCAAAAACGTTTGAAGAC
AATGGCAGATAAGAGGTTTTCAGGTGCAAATGAACAAGGAGGAGTAGAATCGCAGCAGACACGTCAGAATGAGAAGTTTGAAATCAGGGA
GCACCGACTGAGGTTTGCCGATCCCAATATATCAGGTTCATATGCACATAAGGAGGATACTGTTTGTATTTGCAAGAGGAGAGGTGGAAG
TGATAGCAGAGGCCTGATGCATAATCAGTGGTTACAAAGTGTTGATCAGGAGCCTGATGTGATCTCAATGTCCTTCATTCCTATAACTTC
ACTGTTGAATGGCATCTCAGGAAGTGGATTTTTAAGTCATGCTATAAATCTGTACTTACGCTATAAACCACXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan