Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U226435

Score 
659
Direction 
Reverse
Predicted Peptide Sequence 
CLADGTKIAVKCLDGIGQVKTSFLAEVETIGSIHHXKLGAIDWLLAEKSHRLLVYECMSNGSLEKWIYHGKQEQTLDWNCRRKIIQDIAK
GLAYLHEECRQKILHLDIKPPNILLDEKYNAKLADFGLSKLIDRNQSQVMTQMRGTPGYLAPEWLSGVITEKVDVYSFGIVILEILSGRR
HFEALESEDEQVMVNLFRRKAEEGQLVDLIDKHSEDMQFYKEEVVKAMQIAAWCLQSDYTKRPSMSMVVKAMEGVIDVDKDLDYSFRPQT
VSAIPNICFADSAPXTAFGPIRP
Predicted Coding Sequence 
TGCTTAGCGGATGGCACAAAGATTGCAGTGAAATGCCTTGATGGAATAGGACAAGTCAAAACGTCATTCTTAGCTGAGGTTGAAACTATT
GGCAGCATACATCATGXTAAACTTGGTGCAATTGATTGGCTTCTGGCTGAGAAATCTCACAGGCTTTTAGTATATGAGTGCATGAGCAAC
GGATCACTAGAAAAATGGATCTACCACGGGAAACAGGAGCAAACTCTAGACTGGAACTGCAGGAGGAAGATTATTCAAGACATAGCCAAA
GGATTAGCCTACCTTCACGAAGAATGCAGGCAAAAGATTCTGCATTTGGATATTAAGCCCCCAAACATACTCCTGGATGAGAAGTACAAT
GCTAAACTCGCTGACTTTGGGCTTTCAAAGCTAATTGATCGGAATCAGAGCCAAGTTATGACTCAGATGAGAGGCACTCCTGGTTATTTG
GCTCCTGAATGGCTTAGTGGAGTTATAACAGAGAAGGTAGACGTCTATAGCTTTGGCATTGTGATCTTGGAAATTTTGAGTGGAAGAAGA
CATTTTGAAGCATTGGAGTCTGAAGACGAACAGGTAATGGTGAACTTATTCAGGAGAAAAGCAGAGGAAGGGCAGTTGGTTGATCTTATT
GATAAGCACAGTGAAGATATGCAGTTTTACAAAGAAGAAGTAGTCAAGGCAATGCAGATTGCTGCCTGGTGTTTACAAAGTGATTACACG
AAGAGGCCATCAATGTCGATGGTGGTCAAGGCCATGGAGGGTGTTATAGATGTTGACAAGGATCTAGACTACAGCTTTAGACCACAAACT
GTTTCCGCAATACCAAATATCTGTTTTGCAGATTCAGCTCCTXTTACTGCCTTCGGTCCTATCAGGCCCTAG\
Edits in Original Sequence 
(5')TGCTTAGCGGATGGCACAAAGATTGCAGTGAAATGCCTTGATGGAATAGGACAAGTCAAAACGTCATTCTTAGCTGAGGTTGAAAC
TATTGGCAGCATACATCATGXTAAACTTGGTGCAATTGATTGGCTTCTGcGCTGAGAAATCTCACAGGCTTTTAGTATATGAGTGCATGA
GCAACGGATCACTAGAAAAATGGATCTACCACGGGAAACAGGAGCAAACTCTAGACTGGAACTGCAGGAGGAAGATTATTCAAGACATAG
CCAAAGGATTAGCCTACCTTCACGAAGAATGCAGGCAAAAGATTCTGCATTTGGATATTAAGCCCCCAAACATACTCCTGGATGAGAAGT
ACAATGCTAAACTCGCTGACTTTGGGCTTTCAAAGCTAATTGATCGGAATCAGAGCCAAGTTATGACTCAGATGAGAGGCACTCCTGGTT
ATTTGGCTCCTGAATGGCTTAGTGGAGTTATAACAGAGAAGGTAGACGTCTATAGCTTTGGCATTGTGATCTTGGAAATTTTGAGTGGAA
GAAGACATTTTGAAGCATTGGAGTCTGAAGACGAACAGGTAATGGTGAACTTATTCAGGAGAAAAGCAGAGGAAGGGCAGTTGGTTGATC
TTATTGATAAGCACAGTGAAGATATGCAGTTTTACAAAGAAGAAGTAGTCAAGGCAATGCAGATTGCTGCCTGGTGTTTACAAAGTGATT
ACACGAAGAGGCCATCAATGTCGATGGTGGTCAAGGCCATGGAGGGTGTTATAGATGTTGACAAGGATCTAGACTACAGCTTTAGACCAC
AAACTGTTTCCGCAATACCAAATATCTGTTTTGCAGATTCAGCTCCTXTTACTGCCTTCGGTCCTATCAGGCCCTAG\(3')GTGAGGAG
GAAGTTCCTTGGAATTTTTGTAAATTTCTTGTTTTTATGCTATTGCAGCTTGTTTGCTGCTGTGTCAATTTAAAAAAAAAAAAAAAAAAA
AAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan