ESTScan Details for Unigene SGN-U226482

Score 
365
Direction 
Forward
Predicted Peptide Sequence 
GDLTGSFSEPEKVNSEVWESMSYQRAERLGYMNLDEEMADTMDEFEEVFYNEDPNLDDFEMVTEGTDTSAAQARKGKDIQGXPVGEIEYN
KAKLQIDKARTNRNYENIPLSGDAVDKECKQVKKGGNFYXLLLQYKISKAYHTSFSAKELGLGYFKT
Predicted Coding Sequence 
GGAGACCTAACTGGTTCATTTTCTGAGCCAGAGAAGGTGAATTCTGAGGTGTGGGAAAGCATGTCTTACCAAAGGGCTGAGAGATTGGGT
TACATGAATCTTGATGAAGAGATGGCAGATACGATGGATGAATTTGAAGAGGTATTCTACAATGAGGACCCAAACCTTGATGACTTTGAG
ATGGTAACAGAAGGGACAGATACATCCGCTGCACAAGCAAGGAAAGGCAAAGACATACAAGGTXATCCCGTGGGAGAGATTGAATATAAC
AAGGCAAAGTTACAGATTGACAAGGCTCGAACAAACAGGAATTATGAGAACATACCTTTGTCTGGAGATGCTGTAGATAAGGAATGCAAA
CAGGTGAAGAAAGGTGGCAACTTCTATGXACTTCTTTTACAATACAAGATTAGTAAAGCCTACCATACTTCATTTTCAGCTAAGGAACTT
GGTTTGGGCTACTTCAAAACATGA\
Edits in Original Sequence 
ATAAAGCTTCTTTGGCCGACATAACATGATTTTATAGAGCGTAGATCGCTATCATACAAACTACATATAATACATTGGGAAACAAGAAAA
AAAAGATCTTTTTTTTTTCTTGATTTTTAATCAATCTA
(5')GGAGACCTAACTGGTTCATTTTCTGAGCCAGAGAAGGTGAATTCTGAG
GTGTGGGAAAGCATGTCTTACCAAAGGGCTGAGAGATTGGGTTACATGAATCTTGATGAAGAGATGGCAGATACGATGGATGAATTTGAA
GAGGTATTCTACAATGAGGACCCAAACCTTGATGACTTTGAGATGGTAACAGAAGGGACAGATACATCCGCTGCACAAGCAAGGAAAGGC
AAAGACATACAAGGTXATCCCGTGGGAGAGATTGAATATAACAAGGCAAAGTTACAGATTGACAAGGCTCGAACAAtACAGGAATTATGA
GAACATACCTTTGTCTGGAGATGCTGTAGATAAGGAATGCAAACAGGTGAAGAAAGGTGGCAACTTCTATGXACTTCTTTTACAATACAA
GATTAGTAAAGCCTACCATACTTCATTTTCAGCTAAGGAACTTGGTTTGGGCTACTTCAAAACATGA\(3')TGTGTATCTTATATCGAA
CTACTCACTTATG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan